Sequence of DPV Pelargonium flower break virus

Pelargonium flower break virus isolate CZ clone 2 putative movement protein (p7), putative movement protein (p12), and coat protein (CP) genes, complete cds.

ACC No: DQ443029

Dated: 2006-08-01 | Length: 1828 | CRC: 1704776463

                
ID   DQ443029; SV 1; linear; genomic RNA; STD; VRL; 1828 BP.
XX
AC   DQ443029;
XX
DT   06-APR-2006 (Rel. 87, Created)
DT   01-AUG-2006 (Rel. 88, Last updated, Version 2)
XX
DE   Pelargonium flower break virus isolate CZ clone 2 putative movement protein
DE   (p7), putative movement protein (p12), and coat protein (CP) genes,
DE   complete cds.
XX
KW   .
XX
OS   Pelargonium flower break virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1828
RX   PUBMED; 16873268.
RA   Rico P., Ivars P., Elena S.F., Hernandez C.;
RT   "Insights into the selective pressures restricting pelargonium flower break
RT   virus genome variability: evidence for host adaptation";
RL   J. Virol. 80(16):8124-8132(2006).
XX
RN   [2]
RP   1-1828
RA   Rico P., Ivars P., Elena S.F., Hernandez C.;
RT   ;
RL   Submitted (06-MAR-2006) to the EMBL/GenBank/DDBJ databases.
RL   Biologia del estres, Instituto de Biologia Molecular y Celular de Plantas,
RL   Avda. de los Naranjos s/n, Valencia, Valencia 46022, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1828
FT                   /organism="Pelargonium flower break virus"
FT                   /specific_host="Pelargonium"
FT                   /isolate="CZ"
FT                   /mol_type="genomic RNA"
FT                   /country="Czech Republic"
FT                   /clone="2"
FT                   /db_xref="taxon:35291"
FT   gene            193. .399
FT                   /gene="p7"
FT   CDS             193. .399
FT                   /codon_start=1
FT                   /gene="p7"
FT                   /product="putative movement protein"
FT                   /db_xref="GOA:Q70WT9"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:Q70WT9"
FT                   /protein_id="ABD93289.1"
FT                   /translation="MASKVIVPDLGSDNEIDVSVGGRGNRGKQKGKISVAKDAVSKRTS
FT                   DGGNGGSWVVVAETVSVNIHFNF"
FT   gene            233. .553
FT                   /gene="p12"
FT   CDS             233. .553
FT                   /codon_start=1
FT                   /gene="p12"
FT                   /product="putative movement protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q1PGG9"
FT                   /protein_id="ABD93290.1"
FT                   /translation="MRLTCQWEDVGTGENRRVRYPSQRTLSPSGHLMVVMGVLGLLWLR
FT                   PFRLIYTSTFSMPPLINLQHILNLTLLSLILSSFILAERVTHNQYSNDNSKAQYIRIST
FT                   GQ"
FT   gene            555. .1592
FT                   /gene="CP"
FT   CDS             555. .1592
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q1PGG8"
FT                   /db_xref="UniProtKB/TrEMBL:Q1PGG8"
FT                   /protein_id="ABD93291.1"
FT                   /translation="MDAYKNDPIVRQAVAKGVAWAVKLNTRGWSSLTTQQKKAARSALS
FT                   VIQSPAVVVPRRTRVRNPVPAGLKSGNGKAGKSSTLTRSEFICNVSSTTGVTPTFQSWT
FT                   INPREVKSFPQSSVCSVGYNKYRITDFRIRFSTSCSDTMNGKVAIGFTPDSSDPVPVDK
FT                   SQLYGMQVYADTPAKESVTLKTAADNTIRFLRDSSSDDAKLVDYGRVVLATYGFDNTAP
FT                   SVIGELFFEYTVVYLDPTYVVALTQHGTLATSSGPPYATLTTTATSTSMELNTHGKWLV
FT                   VWVSADEVINSPVISGSGASGSVTVVSDAQTTVVAVVTANLPGAVISNTSTAAPSSLEW
FT                   YVSRL"
XX
SQ   Sequence 1828 BP; 462 A; 445 C; 482 G; 439 T; 0 other;

dq443029 Length: 1828  01-AUG-2006  Type: N  Check: 3221  ..

       1  atcaggaacg tacaggttag cccagaattc ttctcgggcc tatggttcag
      51  ttagcgagat ggcgcgtttc agtttcttcc tagcatttgg agttatccca
     101  gatgcccaaa ttgccttgga gaaacacata agagacatgc ccgtcgcagc
     151  tgaatttggg cccgatgaaa gtctggcaga ccacacaatt gaatggcttc
     201  taaagtgatc gttcctgatt tgggtagtga caatgagatt gacgtgtcag
     251  tgggaggacg tgggaacagg ggaaaacaga agggtaagat atccgtcgca
     301  aaggacgctg tctccaagcg gacatctgat ggtggtaatg ggggttcttg
     351  ggttgttgtg gctgagaccg tttcggttaa tatacacttc aacttttagt
     401  atgccccctc tgataaacct ccaacacata ctgaatctta ccttgttgtc
     451  cctgattcta agttctttca tcttggcaga gagagtaacg cacaatcagt
     501  actcaaacga caacagcaaa gcgcaatata tacggatctc aactggtcaa
     551  taatatggac gcctacaaga atgacccaat agttaggcag gccgtggcaa
     601  agggagtagc ttgggcggtt aagctgaata ctagagggtg gtcttcattg
     651  accacccaac agaagaaagc tgcgcgctca gctctgtctg tgatacaatc
     701  ccccgcggtg gttgtacctc gcagaaccag agtacgaaac ccagtacccg
     751  caggcctgaa atctgggaat ggcaaggcag ggaagagctc aaccttaacc
     801  cgatcggagt ttatctgcaa cgtatcgagc acaaccgggg tgaccccgac
     851  tttccaatca tggaccataa atcctaggga ggtcaaaagt ttcccacaat
     901  cttccgtctg ctcggttggc tacaacaagt acaggatcac ggacttcagg
     951  attaggtttt ccacctcctg ttccgacact atgaatggga aggtggccat
    1001  tggcttcact cctgattcta gtgatccggt tcctgttgat aagtcacagc
    1051  tgtacggaat gcaggtgtat gctgacactc cagcaaagga gtcagtcacc
    1101  ttgaagacgg ctgcagataa cacgatcagg ttcctgcggg attcatccag
    1151  cgatgatgcc aagctggtgg attatggccg cgtagtttta gccacatacg
    1201  gtttcgacaa cacagctcca tcagtaatag gagagctgtt cttcgaatat
    1251  accgtagttt atctcgaccc tacctatgtc gtggctttaa cacaacatgg
    1301  cacgttggcc acctcatctg gccccccata tgctaccttg accaccactg
    1351  ctacttcaac atctatggaa ttgaacaccc atggaaagtg gctagtggtt
    1401  tgggtctcgg cagacgaggt gatcaactct ccggttatat ccgggtccgg
    1451  ggcaagcgga tccgtaactg tcgttagcga cgcacaaact actgttgttg
    1501  cagtggttac cgcaaacttg ccaggcgccg tcatttccaa cacttcaacc
    1551  gctgcccctt cgtcactgga gtggtacgta tctaggctat gagagggcag
    1601  tcaccctacc ttctgccaga ggttcccgga ggagtagtga tcctttgggg
    1651  gtgattcata gcttggaaag gtcggagagt tggagggagg ccaactgggg
    1701  gaggtgctgg gagcaccaga ggcagtagag caaaaatccg ggtttcatcg
    1751  cctggtgcgg gcgctcaatg ctgctaacaa gttcctgaag gaagaaaggt
    1801  tttggtcgat ggagacctta acccgccc