Sequence of DPV Eggplant mottled crinkle virus

Lisianthus necrosis virus from Zantedeschia sp. coat protein mRNA, partial cds.

ACC No: DQ523229

Dated: 2007-05-16 | Length: 1167 | CRC: -269128306

                
ID   DQ523229; SV 1; linear; mRNA; STD; VRL; 1167 BP.
XX
AC   DQ523229;
XX
DT   16-MAY-2007 (Rel. 91, Created)
DT   16-MAY-2007 (Rel. 91, Last updated, Version 1)
XX
DE   Lisianthus necrosis virus from Zantedeschia sp. coat protein mRNA, partial
DE   cds.
XX
KW   .
XX
OS   Lisianthus necrosis virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1167
RA   Chen Y.-K., Chang Y.-S., Yang C.-C., Chen C.-C., Hsu H.-T., Jan F.-J.;
RT   "Natural infection of Lisianthus necrosis virus in calla lily in Taiwan";
RL   Unpublished.
XX
RN   [2]
RP   1-1167
RA   Chen Y.-K., Chang Y.-S., Chen C.-C.;
RT   ;
RL   Submitted (02-MAY-2006) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, National Chung Hsing University, 250 KuoKuang Road,
RL   Taichung 402, Taiwan
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1167
FT                   /organism="Lisianthus necrosis virus"
FT                   /specific_host="Zantedeschia sp."
FT                   /lab_host="Nicotiana benthamiana"
FT                   /mol_type="mRNA"
FT                   /country="Taiwan"
FT                   /db_xref="taxon:334425"
FT   CDS             1. .1167
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ABF56559.1"
FT                   /translation="MEIVRRNNNNAIAINKKQLASMAATAAAGALSNYVKNNGAMIVQG
FT                   AVNMGKKAYGAVRNRRNKGNSQAMVHVGGMGGAMMAPVAVSRQLVGSKPKFAGRTAGSV
FT                   TVTHREYLTQVNNSPAFTTNGGIVGNLLQLNPLNGTLFSWLPAIASNFDQYVFNSVMLH
FT                   YVPLCGTNEVGRVAMYWDKDSEDPEPVDRVELANFGILKETAPWAEAILRVPTDKTKRY
FT                   CDDSTVVDRTLIDLGQLGISTYGGTGTNPVGDVFVSYSVTLYFPQPTNTLLSTRQLNLT
FT                   GALEASTGPGYINVTRTPTLLTITFRSTGTFLLSGVFRDTSVAVLGVAGGIGINSQTTL
FT                   DVVGVATSFLVNCTVSTLPATLTYGSAGITSVTANCTRATRANTATLL"
XX
SQ   Sequence 1167 BP; 306 A; 269 C; 306 G; 286 T; 0 other;

dq523229 Length: 1167  16-MAY-2007  Type: N  Check: 3785  ..

       1  atggaaatcg ttaggagaaa caataataat gcaatcgcga tcaataagaa
      51  acagctggcc tctatggcgg ctactgccgc cgctggggct ctgagcaatt
     101  atgtgaagaa caatggagca atgattgtac aaggtgcggt gaatatgggc
     151  aagaaagctt atggagcagt aaggaatcgt aggaataagg gtaattcaca
     201  ggcgatggtg cacgtaggtg gtatgggcgg ggctatgatg gcccctgtgg
     251  cagtatcccg gcaacttgtg ggcagtaagc caaagttcgc aggtaggact
     301  gctggatcag tcacagtcac ccaccgtgag tacttaaccc aggtgaacaa
     351  ctcccctgct tttacaacca atggaggtat tgtcgggaat ttgttacaac
     401  tcaacccgct taatggcaca ctgttttcgt ggttaccggc tatcgcgtcg
     451  aacttcgatc agtacgtctt taacagcgtt atgttgcatt atgtccccct
     501  ctgtggcaca aatgaagtag ggcgtgttgc aatgtactgg gataaggact
     551  ctgaggatcc tgagcctgtg gatagagtgg aattagctaa tttcggtata
     601  cttaaagaga cggccccatg ggccgaagct attctgaggg tcccaactga
     651  taagacgaaa cgatactgcg atgacagtac agtggttgac aggacgctta
     701  tcgacctcgg acagctcgga atatctacat atggagggac cggaactaat
     751  cctgtggggg atgtgtttgt gtcgtatagc gttacgcttt acttcccaca
     801  acccacgaat accctactca gcacacgaca gcttaacctt actggcgccc
     851  tagaagcatc tactgggccc ggatatatta acgtaacacg tacaccaacg
     901  ctcttgacaa taacattcag gtctaccgga actttcctgc tttcgggggt
     951  tttccgggat actagtgttg ctgttcttgg tgtggcgggg ggcataggaa
    1001  ttaatagtca gaccacactt gatgttgttg gcgtagccac atcattcctt
    1051  gtgaactgta cagtgtccac actacccgct acactcacat atggatctgc
    1101  tgggataaca tctgtcactg cgaattgcac acgggccaca agggccaaca
    1151  ccgcaacatt gctatag