Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone 15.10 capsid protein gene, partial cds.

ACC No: DQ660343

Dated: 2007-06-01 | Length: 669 | CRC: 1249269562

                
ID   DQ660343; SV 1; linear; genomic RNA; STD; VRL; 669 BP.
XX
AC   DQ660343;
XX
DT   01-JUN-2007 (Rel. 92, Created)
DT   01-JUN-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone 15.10 capsid protein gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-669
RA   Silva G., Fonseca F., Santos C., Nolasco G.;
RT   "Presence of CTV in Angola and S. Tome and Principe: Characterization of
RT   isolates based on coat protein gene analysis";
RL   Unpublished.
XX
RN   [2]
RP   1-669
RA   Silva G., Fonseca F., Santos C., Nolasco G.;
RT   ;
RL   Submitted (29-MAY-2006) to the EMBL/GenBank/DDBJ databases.
RL   CDCTPV, UAlg, Campus de Gambelas, Faro 8005-139, Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .669
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="sweet orange"
FT                   /mol_type="genomic RNA"
FT                   /country="Sao Tome and Principe"
FT                   /clone="15.10"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .>669
FT                   /codon_start=1
FT                   /product="capsid protein"
FT                   /protein_id="ABG56400.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYLQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 669 BP; 197 A; 124 C; 169 G; 179 T; 0 other;

dq660343 Length: 669  01-JUN-2007  Type: N  Check: 3709  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag ctgagtcttc tttcggttcg ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatctg tttcttacct tgaaagggaa
     201  gtatcccaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtgtga cgtacactcg ggaaggtgtt gaagtggagt tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtact tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgt