Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone 15.11 capsid protein gene, partial cds.

ACC No: DQ660344

Dated: 2007-06-01 | Length: 669 | CRC: -1477706780

                
ID   DQ660344; SV 1; linear; genomic RNA; STD; VRL; 669 BP.
XX
AC   DQ660344;
XX
DT   01-JUN-2007 (Rel. 92, Created)
DT   01-JUN-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone 15.11 capsid protein gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-669
RA   Silva G., Fonseca F., Santos C., Nolasco G.;
RT   "Presence of CTV in Angola and S. Tome and Principe: Characterization of
RT   isolates based on coat protein gene analysis";
RL   Unpublished.
XX
RN   [2]
RP   1-669
RA   Silva G., Fonseca F., Santos C., Nolasco G.;
RT   ;
RL   Submitted (29-MAY-2006) to the EMBL/GenBank/DDBJ databases.
RL   CDCTPV, UAlg, Campus de Gambelas, Faro 8005-139, Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .669
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="sweet orange"
FT                   /mol_type="genomic RNA"
FT                   /country="Sao Tome and Principe"
FT                   /clone="15.11"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .>669
FT                   /codon_start=1
FT                   /product="capsid protein"
FT                   /protein_id="ABG56401.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSMNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 669 BP; 191 A; 123 C; 175 G; 180 T; 0 other;

dq660344 Length: 669  01-JUN-2007  Type: N  Check: 2618  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcggttcc atgaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggaacc
     151  caacagaacg ccgctttgaa cagagatttg tttcttactt tgaaagggaa
     201  gtatcctaac ttgcctgaca aggataagga cttccacata gctatgatgt
     251  tatatcgttt agcggttaag agttcatcgt tgcaaagtga tgatgacacc
     301  acgggcataa catatactcg ggagggtgtt gaagtggatt tgtctgacaa
     351  gctttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  atgcccttcg agtctggggt aggactaacg atgcccttta tttagctttc
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  gattccggct ggatatcatt acctatgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa ggaacaattg
     601  ttgaagaagc gaggggctga cgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgt