Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone F12 capsid protein gene, partial cds.

ACC No: DQ660347

Dated: 2007-06-01 | Length: 669 | CRC: 600948802

                
ID   DQ660347; SV 1; linear; genomic RNA; STD; VRL; 669 BP.
XX
AC   DQ660347;
XX
DT   01-JUN-2007 (Rel. 92, Created)
DT   01-JUN-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone F12 capsid protein gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-669
RA   Silva G., Fonseca F., Santos C., Nolasco G.;
RT   "Presence of CTV in Angola and S. Tome and Principe: Characterization of
RT   isolates based on coat protein gene analysis";
RL   Unpublished.
XX
RN   [2]
RP   1-669
RA   Silva G., Fonseca F., Santos C., Nolasco G.;
RT   ;
RL   Submitted (29-MAY-2006) to the EMBL/GenBank/DDBJ databases.
RL   CDCTPV, UAlg, Campus de Gambelas, Faro 8005-139, Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .669
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="sweet orange"
FT                   /mol_type="genomic RNA"
FT                   /country="Angola"
FT                   /clone="F12"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .>669
FT                   /codon_start=1
FT                   /product="capsid protein"
FT                   /protein_id="ABG56404.1"
FT                   /translation="MDDETKKLKNKNKAKEGDDDVVAAESSFGSLNLPLDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTREGIEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLKCAVYIQAKEQLLKKRGADEVVVHQVRQLGKFNT
FT                   R"
XX
SQ   Sequence 669 BP; 195 A; 126 C; 170 G; 178 T; 0 other;

dq660347 Length: 669  01-JUN-2007  Type: N  Check: 3590  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg cgaaagaagg
      51  cgacgacgat gttgttgcag ctgagtcttc tttcggttcg ttaaacttac
     101  cactcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcccaac ttacctgaca aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaaa agttcatcat tacaaagcga cgatgatacc
     301  acgggtgtga cgtacactcg ggaaggtatt gaagtggagt tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttaaaatgt gcagtgtaca tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggtcgta gttcatcagg tcaggcagct
     651  tgggaaattc aacacacgt