Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone O2 capsid protein gene, partial cds.

ACC No: DQ660348

Dated: 2007-06-01 | Length: 669 | CRC: -1090220099

                
ID   DQ660348; SV 1; linear; genomic RNA; STD; VRL; 669 BP.
XX
AC   DQ660348;
XX
DT   01-JUN-2007 (Rel. 92, Created)
DT   01-JUN-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone O2 capsid protein gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-669
RA   Silva G., Fonseca F., Santos C., Nolasco G.;
RT   "Presence of CTV in Angola and S. Tome and Principe: Characterization of
RT   isolates based on coat protein gene analysis";
RL   Unpublished.
XX
RN   [2]
RP   1-669
RA   Silva G., Fonseca F., Santos C., Nolasco G.;
RT   ;
RL   Submitted (29-MAY-2006) to the EMBL/GenBank/DDBJ databases.
RL   CDCTPV, UAlg, Campus de Gambelas, Faro 8005-139, Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .669
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="sweet orange"
FT                   /mol_type="genomic RNA"
FT                   /country="Angola"
FT                   /clone="O2"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .>669
FT                   /codon_start=1
FT                   /product="capsid protein"
FT                   /protein_id="ABG56405.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMKDV
FT                   RQLGTQQNAALNRDLFLTLKGKHPNLPDRDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 669 BP; 198 A; 128 C; 164 G; 179 T; 0 other;

dq660348 Length: 669  01-JUN-2007  Type: N  Check: 1437  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgccg ctgagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc aactctgata gcgatgaaag acgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactt tgaaagggaa
     201  gcatcctaac ttacctgaca gagataagga ctttcactta gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga tgacgatact
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggc aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaaa atcgcaattt gagttacggt ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttctta accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagttgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgt