Sequence of DPV Strawberry chlorotic fleck-associated virus

Strawberry chlorotic fleck associated virus, complete genome.

ACC No: DQ860839

Dated: 2007-02-27 | Length: 17039 | CRC: 1141172406

                
ID   DQ860839; SV 1; linear; genomic RNA; STD; VRL; 17039 BP.
XX
AC   DQ860839;
XX
DT   26-AUG-2006 (Rel. 88, Created)
DT   27-FEB-2007 (Rel. 90, Last updated, Version 3)
XX
DE   Strawberry chlorotic fleck associated virus, complete genome.
XX
KW   .
XX
OS   Strawberry chlorotic fleck associated virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus; unclassified Closterovirus.
XX
RN   [1]
RP   1-17039
RX   PUBMED; 17109984.
RA   Tzanetakis I.E., Martin R.R.;
RT   "Strawberry chlorotic fleck: Identification and characterization of a novel
RT   Closterovirus associated with the disease";
RL   Virus Res. 124(1-2):88-94(2007).
XX
RN   [2]
RP   1-17039
RA   Tzanetakis I.E.;
RT   ;
RL   Submitted (20-JUL-2006) to the EMBL/GenBank/DDBJ databases.
RL   Botany and Plant Pathology, Oregon State University and USDA-ARS, 3420
RL   Orchard Ave, Corvallis, OR 97330, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .17039
FT                   /organism="Strawberry chlorotic fleck associated virus"
FT                   /specific_host="Fragaria vesca clone NCRG 9018"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /db_xref="taxon:399314"
FT   5'UTR           1. .227
FT   CDS             228. .8591
FT                   /codon_start=1
FT                   /product="polyprotein 1a"
FT                   /note="p312"
FT                   /db_xref="GOA:Q0GK55"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR000606"
FT                   /db_xref="InterPro:IPR002588"
FT                   /db_xref="InterPro:IPR008749"
FT                   /db_xref="UniProtKB/TrEMBL:Q0GK55"
FT                   /protein_id="ABI23183.1"
FT                   /translation="MAGSHHNPWPFIGYSPGSGSFIKTHLAPVYYADGGTLKSKLPVRT
FT                   DRPCTTASISSKMLGASRAAKLNSGVGPRRTPAKVRRSQVPEWILNHSSVAFDATLKIF
FT                   KTIKSPKQNNPYNTLLITSKGVLYVESLGNVYAKPTRGCVTRFAVGEQGPVPVFCSRRW
FT                   RKTPQTECNSVASSSTPSSGVRKLSQEASALGKRKRLRKGSPFTPKTAEYHNSPVCETR
FT                   TYYNDQQASPVVARKSAYKYPYPSDTVFDSCGRVKPSADALFLKATSLDHLVKTAVRRT
FT                   ENHIPAVNSLRTCYVCKWGKVFVTPINGVYAEIKVIKGGQSATFSVRAPAFCSHKIYFE
FT                   TGEGVESLNQFFKFPSVADGRCYLAHVFLVAVTLGVTAKFWKFTSLGSFPSLKAFRVRL
FT                   ASVFGPEALDVAFRATIKGKLAHCDLSSPLTDLPEDCIVGGIYKALPLESRFVKQAPVD
FT                   EVDFKKAPFTGVLPVTKLDAVVEFVTTYLHNFALGDVRFFNHFISRNRRVEVCLVGTTD
FT                   KLVRVFIRMGSRWTSFDYEALEYAPYFLFFKTGEVIPEYVDREFAEGYCYMNFLYYTSL
FT                   TVNRPFGVFTAMKTLGKFPTATKLLWFIRSRFGGPGRKILVRGHFTSNKKIFHVDSTSS
FT                   RIYNLAKMGYTVRVGGDDDEKSLITTSADKLKALNLVYDKLSNSRDSILVKSIEKEMID
FT                   FSAVIESLNKQKEAIKVPFRMGEQSQVALTAAYPEFNIVFSHSVHSDHPAAAGSRLLEN
FT                   ALLHKYAVINYSDIGGCPKHHLSAKHVGVHVCRPVLDAKDAQRRVMRHEAYKSMIMDTD
FT                   KLSEVVSATSELTTCARSITDCTHKSKVFTMVQVYDIPLLDLCTAMEKRDCSITFATMI
FT                   TPGEILDGRSHFSVESLNLEIEISSDEDLIVYRFAGSCYSHSLKTVKGYMTTPYLKLGK
FT                   YLFCVEMNSLRNSVNHYVITKSEVSPLIRGPRHLRFRRAEHGITRVKIPKYCSKTRVCL
FT                   PGCDIVYLDTKYVSRVYEYIMNTCSVINQKTFEWAFNFAKSAKSRVVISGKIIHREINL
FT                   PMKYVDGFTAVMLAAGVKAKQNAEFFSKRLSLYSGDASYLQLVMFALEEKFKGALDAFN
FT                   AYVTSVVKNMLTDGFGVHFMEIEDPFEEVGEYHDLVVNVDISPSGEIVESEETSLIEAE
FT                   VKNALLRDSAAKYVAEETASEAKYVLPRFRNNARKGEAKPGEGLYAGSSSTGSCFSKFF
FT                   DFLSSATTDLKEFIVSWASQYLGSNMVGLSKLRELINTIIKVCGEAHLKTKEGFSMLWS
FT                   LLSSAITIVKDLTKEKYEKFLSFCESFIKTINMSVEKTRSFCLAIFEFLGAICSGIKVR
FT                   YLTVSSNLFSFCLQNSDGKAVVFECLVSLFMANHGSDFLFGKISLQFFILKCVSQIILE
FT                   YYANCFALECFGAPELYAQEFFRRGVSNFLACISTRGVILDTVGVVQLSTVAPMIVRRI
FT                   LGLVFSETSPHLAYIKHAASDFPIQAYLKCLYDSHVFTRESLELYVTDLCKSLVSSVLS
FT                   KDVLGVKTLIKDNMVTRVFSRLHPRSYFIPKVECAVSSALSSLKAIEEKVVAKTSGVYS
FT                   FAADNISAQYLKVANNRGFSKHKFSNTAVVVAEDEDDCHTAPEIQRMHSGSDSELSEIS
FT                   TFPEGCEEEVFHDFIEDGQLSLLNSFKSYLLQYFVSTERKTPGLGGGSRRRGVMNLLMR
FT                   YLNYFLDCVSSIDIRGVQSSLYLAVKDVIFTNLPKYCLAVLSYNLIPLMKCSFPVLFDR
FT                   NLVNEAFMYSHLIHNCAELAYRISNTEWYLRAEDAIRRCCGFETRSSMEHKRRVSAYVE
FT                   AMPGIIAALANRGVLNLSGNIPSDIVALLDNAQQSNPNEDNLSGENSSTPEGSDWDFEY
FT                   VQHRLAEGSTFVAEDVFSANLGFNAPLNNTSEIVELIEDPESLGLENDWNIGALSDEDL
FT                   GEFSDLESSEGGLRGAGIGAVTVVSILKFLLRICFKTILHPVVLKSFVKSVLVYITHTV
FT                   KFVGPVVKGVTFPTYSIIRTLAKLLSYVQHFGGTLGRISDRLYFPMRLKTFTRKLADFM
FT                   MCSEYSLTAVRIGNFLIRCESQVFEYIKSILRSRGKTHKAVSVSSCQFKAVSVSEDDDD
FT                   NFEAPAVAKDFLNTVQDAEKLLLVKERLSLRADREKRHNGKGSETAMSEAESSSDSDEE
FT                   EAVMGASEEKTEKCEEEIKVPSEKTVLHAEAEAFRVLEIGECSDTSTALRRSSKSRAEV
FT                   VQSKSSSKVPMCAYLNQLNSMQMVPLNYHEDSSSDPFRRMTNAMREFYYTQEVTLYEVY
FT                   QKMADYWADFSACGFDRKYSKIDQDDKLFVLDFKLQKLIGKSATLNLKGVYSEYQFGFC
FT                   SDGLIPLTAMGRKYDYCLIHDQLKILSSNLFLCSCPSRLVKYTNCDIRIRVYEAPPGGG
FT                   KTYALVQTYCRMIKKKSVIVITANKESQLEIVRRAKSELKGNLKEGENLSLGDLKKLTS
FT                   TIYTVDSYLMHHINVKGDIMLVDECFMMHAGAVTAAFQFSQCKKAALYGDSRQIHYIQR
FT                   NDLGCSLLHDINDFLSDEVRVYGDVSFRCPWDVCEWLSLTYPVHIRSTNEDSVGKSSMR
FT                   VVCINSVEEVPVDQDHVYLTYTQDEKRDVRKHLLKSVTDCPVVLTVHEAQGATYKYVNL
FT                   VRVKFQENTPFSSYNHINVALSRHTDHLVYYVLVNRSMDDTASAITRTKKLVDRFRVYP
FT                   QEFSTSTLQWNMGDMYEGKEECKAVSTPYQCINDFLEDVVVGSTTLDFGDMSSELSDQP
FT                   FECGVDGVIIREGNNLRNNGVAQNPARV"
FT   mat_peptide     228. .1544
FT                   /product="leader protease 1"
FT                   /note="p48"
FT   mat_peptide     1545. .2177
FT                   /product="leader protease 2"
FT                   /note="p24"
FT   mat_peptide     2178. .8588
FT                   /product="methyltransferase/helicase"
FT                   /note="p240"
FT   CDS             <8590. .9999
FT                   /codon_start=1
FT                   /product="RdRp"
FT                   /note="p54; ORF1b; probably translated via a +1 ribosomal
FT                   frameshift"
FT                   /db_xref="GOA:Q0GK54"
FT                   /db_xref="InterPro:IPR001788"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:Q0GK54"
FT                   /protein_id="ABI23191.1"
FT                   /translation="SYVRSQAIPDRKASLQENLYSFESRNYNFLDCERFSSPKQFGIAM
FT                   AMAVLKSCFNLEKFSTLKDDLIAISEKNILKWLKKRDESSCKALMKDIEKPFDLETEIS
FT                   NFKLMVKKEAKVKLDDSCLSKHPPAQNIMFHRKAVNAIFSPVFDEFKNRVLYCLNSNIV
FT                   FFTEMTNDHFSQILRRLLGDQDVYNVGEIDFSKFDKSQDIFVKEYERTLYEAFGIDSEL
FT                   LNVWMQGEYSAKATTLDGSLSFSVDNQRRSGGSNTWIGNSLVTLGIIALYYDVSKFRLL
FT                   AISGDDSLIYSDNKIANFATEICLESGFETKFMSPSVPYFCSKFVVQTGTNTVFVPDPY
FT                   KLMVKLGASNKFVTNEGLFEVYTSFRDLTKDYGNQIVLERLKHLVEKKYNFESGTTLPA
FT                   LQALHCLRSNFMSFARLFPRISGWWMVDPRNLKFFVKLPGIIIERVNEERDSRYFVSLL
FT                   DSAEATVVSQD"
FT   CDS             10042. .10788
FT                   /codon_start=1
FT                   /product="p28"
FT                   /db_xref="UniProtKB/TrEMBL:Q0GK53"
FT                   /protein_id="ABI23192.1"
FT                   /translation="MSTLLSLQKVNRFVCVVVPDSWTGDVFGFNVNKSQANKFSYGDYA
FT                   YISMQEDLSKSHVILFAFEEDNMYHIKYIQTISSSISVSSTDEVVKDFTVEDLSAVKFT
FT                   LRVLRDESILSCEVHEMRVKVKVGYSSFIKFGTISYVPPGEGHINTVKPSFQFVFDTLR
FT                   SDLSSETVIVESGCPTATACSLTPAKSPFSQGALFEELEASESYRDHEEKIYRCLRASS
FT                   MVSFIICFGLVIAVVVVLIMNSQNHG"
FT   misc_feature    10699. .10767
FT                   /note="transmembrane-region site"
FT   CDS             10797. .10991
FT                   /codon_start=1
FT                   /product="p7"
FT                   /db_xref="UniProtKB/TrEMBL:Q0GK52"
FT                   /protein_id="ABI23184.1"
FT                   /translation="MNCYERSDLDLLLGCATCAIIVFLVFICMYAYSTRPTFNKPSVSR
FT                   SRAGNSDFQPPVSSYATIS"
FT   misc_feature    10803. .10805
FT                   /note="possible dimerization binding site"
FT   misc_feature    10830. .10898
FT                   /note="transmembrane-region site"
FT   CDS             10999. .12777
FT                   /codon_start=1
FT                   /product="HSP 70h"
FT                   /note="p65"
FT                   /db_xref="GOA:Q0GK51"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:Q0GK51"
FT                   /protein_id="ABI23185.1"
FT                   /translation="MVVFGLDFGTTFCTLSVCCSKEIVLLKQNGYSFIPTTIFLCLDDT
FT                   VLYGYDADYAHASGWSGFYYKDLKRWVGCTDKNFYTYMDKLKPDYEARLSLVGKGTLKT
FT                   VELPSLSNTKRYIPLPELIALYTKCIVKDAERAFTLTCTGVICSVPAGYNTIQRAFTEQ
FT                   SISRSGFPCVYMLNEPSAAALASAPMLKSEDKRLLIYDFGGGTFDVSAVTVEGATFVVK
FT                   SSAGDMNLGGRDIDLALSNFLKKLAKSDYVGELAVTSLKEGLSMAEGKIKYLVPSSNGD
FT                   VEVVVSTSMLNEICSPFIKRTLKIVEKVREKARFSAEHGAKVVVVGGSSTLPGLCDELN
FT                   AVHGISGLVRLLDHRAAVSYGCALYAKCLTSASNVLMVDCATSNICLPGTCADCIVVIP
FT                   SGAPIPFDGERTIHINNASINSYYDARLFEGNYTKAPRNELIYSSRVLLKDLGLNNRQL
FT                   TTVTVKLHTKIDSVGKITYDITGPSGVRKSVVGLPHYDFSNISVGFGYKIKYLSDTNRN
FT                   AAALILCVTLDPEARASYSFHKEDYLCEINDAKPLETYRSKYDVASSYRISESRSRMGK
FT                   AVQKILRGAAVERLPL"
FT   CDS             12677. .14275
FT                   /codon_start=1
FT                   /product="CPh"
FT                   /note="p61"
FT                   /db_xref="InterPro:IPR004909"
FT                   /db_xref="UniProtKB/TrEMBL:Q0GK50"
FT                   /protein_id="ABI23186.1"
FT                   /translation="MSQVPIGSRNLGHEWGRLFKKFYGEPLWRDYLSRSAGSYRPELLK
FT                   EGYMSADGKFITSEELAKAETGSVRHELAILIYSDSIYKWSDICGSTPRSIFEGVAGMS
FT                   LPNGEFLEVDTMRTGCKFDIDVVKGFLNYDEMEKDSEKELHAEHTWALSNATGTLMDAS
FT                   HVEKFKTILFKDNTNLDITDNIHNVYGDYLSYLIELYKRHVIISHDELNLRRDFISYVI
FT                   DYLNAYDFGYADYSDNPLITGFLLDFMIHNRVYTSTYSVNLSNLRLFISKVLPVMLDTW
FT                   VIATPKIIKDERLCIPISAVELVSSLPSLNLYDRTVLVGDKLMSLEYRFEYEAIESMVD
FT                   KVKATLLESNKLSGVSELHLFDTFYVYYAVFCTAKERTIRRPAQYMLYKGESVSMEEVE
FT                   DLFDSLQKASYDVNVRRCVLGAMGDRGFECYKRLGLRFPPKSDYVVPDHMAYLNVDFYK
FT                   QLDESVLTPEESHHLSNIRRRVDVKCNNLVSLKKTVFKDSSSSFSNVVKYPNSARTKKV
FT                   AYSRIPRSVRNNGSI"
FT   CDS             14304. .14981
FT                   /codon_start=1
FT                   /product="CPm"
FT                   /note="p25"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q0GK49"
FT                   /protein_id="ABI23187.1"
FT                   /translation="MALVNSEVSALQSNELSTNNNAIPNSLDSVLVLSSISESSIDHYT
FT                   SEEIPKVLNDLQTFLITKYSIRPEHILSHAAMIVKRAATISTSMEARLVPGSHISYDLK
FT                   TSDGTVLHYKLEDTVVFGYIRTWKDEVSNPNPVRKLRCTLEILHEWLAHKRPEIYETKR
FT                   TTKLGLPKGKAYLGADFLSGNVSTLSEHDRAILLRSSEVALNRPSKSPKVSLTSLYDMV
FT                   KEF"
FT   CDS             15058. .15645
FT                   /codon_start=1
FT                   /product="CP"
FT                   /note="p21"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:Q0GK48"
FT                   /protein_id="ABI23188.1"
FT                   /translation="MPEVRYSDITGLSVGNSTATNTADAALVAKDILAKVKETNPTLTD
FT                   DHLNLIWGVVLLRLAVRTTSEKSLGFEETTFKIGDVEYKIKDEDFVNVVDKHVKTRFEK
FT                   NPLRHWARGSNAAYLDIARKTPNEIMSARALKCGLPKDVGYLCADFLVGSGLSDFERTC
FT                   YLQAQNHMLAEKAGIPATGTLTTIANLGYYKA"
FT   CDS             15654. .16187
FT                   /codon_start=1
FT                   /product="hypothetical protein"
FT                   /note="p20"
FT                   /db_xref="UniProtKB/TrEMBL:Q0GK47"
FT                   /protein_id="ABI23189.1"
FT                   /translation="MELIQHPTDVRMSRPERLNFTTYIWNDGVLNLLVCKDIKHASDLV
FT                   PYSNCCIISKTGYLCNDGFSYVVGAPETNLLYDLLDKLKKQPKMEFFPFSLLCTATFNQ
FT                   NRVLFSNESRLVAFLKNGKRMEFTNSYEPTTTIVIYQGDTDMFTSSSFEGDLLSCMLKA
FT                   FPVGAYKNVHFFSD"
FT   CDS             16243. .16824
FT                   /codon_start=1
FT                   /product="putative silencing supressor"
FT                   /note="p22"
FT                   /db_xref="UniProtKB/TrEMBL:Q0GK46"
FT                   /protein_id="ABI23190.1"
FT                   /translation="MRGYYDVQAFKDLNNHYVSCIHVVGAVERRTDGLKQHCLEFNNSL
FT                   AIKAALKCDANSDVMSRKNSAKEKLEILTEIDANCAILLKLLRKKVVRYELGVRSMQGT
FT                   FDYIYQKYSSLHPEVPHSEILRHKITPAAQEVIEALSEEYKLSLSDRSFPGFLVLGVST
FT                   GTNRLSFATAADQADLVTENDDFVNVRMES"
FT   3'UTR           16825. .17039
XX
SQ   Sequence 17039 BP; 4780 A; 3032 C; 3964 G; 5263 T; 0 other;

dq860839 Length: 17039  27-FEB-2007  Type: N  Check: 1222  ..

       1  gtttttaaac cacttttctt acgttgcttc cgccgaggtc gatcaacgta
      51  acctgaagac tcagtccaag tcttttctat cccactaccc ccttactcta
     101  ccgctcacgt ggtttgaata tttcctttaa cgtccccaag ctctcacgct
     151  cttttaatct tttgttgaag atttctgtta acttttcgtt ttacaacgaa
     201  gtccccgata atcaaccgtg ttaactcatg gctggttccc atcacaatcc
     251  atggcctttc ataggctaca gtcctggttc gggttccttt ataaaaaccc
     301  atttggcccc cgtctattat gctgatggcg ggacccttaa gtccaagctg
     351  cctgttcgca ccgacaggcc atgcactact gctagcatct catcgaagat
     401  gcttggagcg tcccgagctg caaagctcaa ctctggtgtt ggacctcgtc
     451  gtactcctgc caaagtacgt cgttctcaag tccctgagtg gatccttaac
     501  cactcttcag ttgcttttga tgcaacttta aaaattttca agaccataaa
     551  gtcccctaaa caaaacaatc catacaatac tctactgatc acctcgaaag
     601  gggtgcttta tgtagagtcg cttggcaatg tgtatgccaa gccaacacgc
     651  gggtgcgtga ctaggttcgc cgttggcgaa cagggtcctg tccccgtgtt
     701  ctgctccagg cggtggagga aaacaccgca gacagagtgt aactctgttg
     751  caagctccag tacccccagt agcggggtta gaaagttgtc ccaagaagct
     801  tcggccttgg gaaaaaggaa aagactgaga aaggggagtc cttttacccc
     851  taagactgct gagtaccaca acagtcctgt gtgtgaaacc aggacttatt
     901  ataatgatca gcaggcttct cctgtcgtcg ctaggaagtc tgcttataaa
     951  tatccttacc ctagcgacac tgtttttgac tcctgtggga gagtcaagcc
    1001  aagcgcagat gcgcttttcc ttaaagccac ttcacttgac catttggtca
    1051  agactgcagt ccgaaggact gagaatcaca taccggcggt aaacagtctc
    1101  cgcacgtgtt atgtgtgtaa gtggggtaag gtttttgtta ccccaattaa
    1151  cggcgtttac gccgaaatta aggtgattaa gggtggccag agtgctactt
    1201  tttcagtgcg agctcctgca ttttgttcgc acaagattta ttttgaaact
    1251  ggtgagggtg tggaatccct caatcagttt ttcaaattcc catctgtagc
    1301  tgatggaagg tgctatctag cacatgtgtt tttggttgca gtgaccctcg
    1351  gagtcactgc aaagttctgg aaattcacct ctctggggtc atttccatct
    1401  cttaaggcgt tcagagtacg cctagcgagt gtttttgggc cagaagccct
    1451  cgacgtagct tttagagcta ctattaaggg aaagcttgct cactgtgact
    1501  tgagcagtcc cctcactgat ctgcctgaag actgtatagt cggaggcatt
    1551  tataaagctc ttcccttgga gagcaggttt gtgaaacaag ccccagtcga
    1601  cgaggtcgac tttaagaaag ctcctttcac cggcgtgttg ccggtcacta
    1651  agttggatgc agtggtagag ttcgtcacta cttacttgca taattttgct
    1701  cttggagatg tgaggttctt taaccacttc atttctcgca atcgtagggt
    1751  ggaagtgtgt ttggtgggca caacagataa gcttgtgcga gtttttataa
    1801  gaatgggttc taggtggact tcattcgatt acgaggcttt ggagtatgca
    1851  ccttactttt tgttcttcaa aactggtgag gtcatacctg agtatgtcga
    1901  ccgcgaattt gcggagggat actgttacat gaacttcttg tattacactt
    1951  ctttgactgt taacagacct tttggtgtat ttacagcgat gaagactctt
    2001  gggaaatttc caacagctac aaagttgttg tggtttataa ggagtagatt
    2051  cggcggccca ggccgaaaga ttctggtaag aggacacttt accagtaaca
    2101  agaaaatttt tcatgtggat tctacaagct ctcggattta taacctggcg
    2151  aagatgggtt atactgtgcg agttggtggt gacgatgatg agaagtcttt
    2201  gatcactacc tctgcggata agcttaaagc gcttaattta gtgtatgata
    2251  agctgtccaa ttccagagat tcaattcttg ttaagtctat cgaaaaggag
    2301  atgatagatt tttcggctgt gattgagtcg ctgaataagc aaaaggaagc
    2351  tatcaaagtt cccttcagaa tgggtgagca atcgcaagtg gctttgactg
    2401  cagcttatcc agagttcaac atagtgtttt ctcactcggt tcattctgac
    2451  catccagctg ctgcggggtc taggcttttg gaaaatgctt tattgcataa
    2501  gtatgcggtc attaactata gtgatattgg tgggtgtcca aaacaccact
    2551  tgtccgctaa acacgtaggt gttcatgtct gtagaccagt acttgatgct
    2601  aaagacgccc aaaggcgtgt aatgcgtcat gaagcttata aatctatgat
    2651  tatggacaca gacaagttaa gtgaagttgt atctgcaact tccgaactga
    2701  caacttgcgc acggagcatt acagattgta ctcataagag taaggtcttt
    2751  accatggtgc aggtttatga cattcccctt ttagatctct gtactgccat
    2801  ggagaaaagg gactgttcca taacttttgc gacaatgata acaccagggg
    2851  agattctgga tggtagatcg catttttcag tggagtcctt gaacttggaa
    2901  attgaaattt cgagtgatga ggaccttata gtttataggt ttgcagggag
    2951  ttgctactcc cattcactca aaactgtgaa ggggtatatg accacacctt
    3001  atctaaaact tggcaagtac ctgttttgtg tggagatgaa ctcgttaagg
    3051  aattcggtta accactatgt tatcaccaaa tctgaggtga gtcctttaat
    3101  cagaggacct aggcacctta ggtttagacg tgctgaacat gggataacta
    3151  gggttaagat tcccaagtat tgttcgaaga caagagtgtg tcttcctggg
    3201  tgtgacatag tgtatcttga cacaaagtat gtatcaagag tgtatgagta
    3251  cattatgaac acctgttctg tgataaatca gaagactttt gaatgggcct
    3301  ttaattttgc gaagtctgct aaatctagag tggtgatttc aggcaagatc
    3351  atacatcgtg aaataaacct gccaatgaag tatgttgatg ggtttacagc
    3401  cgtgatgtta gcagctggtg ttaaagccaa acagaatgca gagttctttt
    3451  ctaagaggct ttctttatat tctggggatg cttcatatct tcagctagtt
    3501  atgtttgctt tggaagagaa atttaagggg gctcttgacg cttttaatgc
    3551  atatgtaacc tcagtcgtta aaaatatgct gacagatgga tttggagttc
    3601  attttatgga gattgaagac ccctttgaag aagttgggga gtatcatgat
    3651  ttggtcgtca atgtagacat ctctccaagc ggtgagatag tggagagcga
    3701  agaaaccagt cttatagaag cggaagttaa aaatgcttta ttaagagatt
    3751  ctgcggcgaa gtatgtggct gaggagacgg caagtgaagc taagtatgtg
    3801  ttacctagat ttagaaacaa tgctaggaaa ggcgaagcta aacctggtga
    3851  aggtttatat gctggatctt catcgacagg atcatgtttt tcaaaattct
    3901  ttgacttctt gtcgagtgct acgactgact taaaggagtt cattgtaagt
    3951  tgggcgtcgc agtacttagg ttccaacatg gtggggcttt ctaagttaag
    4001  agagcttatt aacaccataa taaaggtgtg cggagaggca catcttaaaa
    4051  ctaaggaggg tttttcaatg ctttggagtt tactaagctc cgctataacc
    4101  atagtcaaag acttgaccaa ggagaagtat gaaaaatttt tatctttttg
    4151  cgagtctttc attaaaacca tcaacatgtc tgttgaaaag actcgtagct
    4201  tttgcttggc aatcttcgag ttccttggtg caatatgcag tggaattaag
    4251  gtgaggtact tgacagtttc ttcaaacctt ttctcatttt gtcttcagaa
    4301  ttcggatggc aaggctgtgg tgtttgaatg cttagtctct ctcttcatgg
    4351  ctaaccatgg aagcgacttt ttgtttggaa agatttcttt acaatttttc
    4401  attttgaagt gtgtgtcgca aattattcta gagtattacg ccaactgttt
    4451  tgccttagag tgttttggag cacctgaact gtatgctcag gaatttttcc
    4501  gaagaggggt gtcaaatttt ttggcctgta tttccactag gggcgtaata
    4551  ttggacacgg tcggtgttgt tcaattgtca actgttgctc ccatgatagt
    4601  gaggagaata ctaggtttag tattctctga aactagtcct catttggctt
    4651  atattaaaca cgcggcttca gattttccga ttcaagccta tttgaagtgt
    4701  ctttatgact ctcatgtgtt cactagggag tctttggagt tgtatgtaac
    4751  agacctttgt aagagtctgg ttagttctgt gctctcaaag gatgtattgg
    4801  gagttaaaac tctaattaaa gacaatatgg tgactagagt tttttctagg
    4851  ttgcacccca gatcttattt cattcccaaa gttgaatgcg cagtgtcatc
    4901  ggcgctctcg agcttgaaag ctattgagga gaaggttgtc gcaaaaactt
    4951  cgggtgttta tagtttcgcg gcagataata tctcagctca gtatcttaaa
    5001  gtggcaaaca accgtggttt ttcgaaacat aaattttcga atactgcagt
    5051  tgtggtagct gaagatgagg atgattgcca cacagcacct gagattcagc
    5101  ggatgcatag tgggagtgat tcggaactat ctgaaatttc gacttttccc
    5151  gagggttgtg aagaagaagt ctttcacgac tttatcgagg atggtcagct
    5201  tagtttacta aattctttta aatcttatct tttacaatac tttgtctcaa
    5251  cggaaagaaa gactccaggt ctgggtggag gttcaaggag gcgaggagta
    5301  atgaacttgt tgatgaggta tctgaattat ttccttgact gtgtttcctc
    5351  tatagatatt aggggtgtac agagttcttt gtacttggcg gtaaaggatg
    5401  tgatattcac aaatctgccg aagtactgtt tagcagtctt atcttataac
    5451  ttaattcctc taatgaagtg ttcattccca gtgttgttcg atcgcaattt
    5501  ggtgaatgaa gcattcatgt attctcattt gattcacaac tgcgctgaat
    5551  tagcgtatag aatctctaat accgagtggt acttgagagc agaggatgct
    5601  atcagaagat gttgtggctt tgaaactagg tcgagtatgg aacacaagcg
    5651  aagagtgtcc gcctatgttg aagcaatgcc aggtataatt gcagctttag
    5701  ctaatagggg agtactaaat cttagtggaa atattcctag tgatatagtc
    5751  gcattgcttg ataatgctca gcagagtaat cctaacgagg ataatctgag
    5801  tggtgaaaac tcgtccactc ctgaggggag tgattgggat ttcgagtatg
    5851  tgcagcatag gcttgcggaa ggttctacat ttgtagctga ggatgttttt
    5901  agtgctaatt tagggtttaa tgctccactt aataatactt cagaaatagt
    5951  ggagctaatt gaggatcctg aatctttggg cctagaaaat gattggaata
    6001  taggagctct ctcggatgag gacttgggtg aattttctga tttggaaagt
    6051  tctgaaggag gtctacgcgg tgctggtata ggcgcggtaa ccgtagtgag
    6101  catcctgaag tttttgttgc gtatatgttt caagacaatt cttcatccgg
    6151  ttgttttaaa aagctttgtg aagagtgtac ttgtgtatat tacgcataca
    6201  gtaaagtttg tagggcctgt ggttaaaggt gttacctttc cgacttattc
    6251  tataatcaga actcttgcga aattgttgtc atatgttcaa catttcggtg
    6301  gaacattagg caggatttct gatcgcttgt attttccaat gcggttaaag
    6351  acctttactc ggaagttggc tgattttatg atgtgctctg aatacagcct
    6401  aacggctgtg agaataggaa actttctgat aaggtgtgaa tcgcaagttt
    6451  ttgagtatat taagagcatc ttacgttcaa gaggtaagac tcacaaagct
    6501  gtaagcgttt catcttgtca attcaaagct gtgtcagtct cagaagacga
    6551  tgatgataac tttgaggctc ctgctgtggc caaagatttc ttaaacactg
    6601  tgcaggatgc tgagaagctt cttttggtga aagagagatt gtctttgaga
    6651  gcagacagag agaagaggca caacgggaaa ggctctgaga ctgccatgtc
    6701  ggaggcagaa agctcttcag acagtgatga ggaagaagcg gttatgggag
    6751  catccgaaga gaaaacagaa aaatgcgaag aagaaataaa agttccttct
    6801  gaaaaaactg tattacatgc cgaagctgaa gctttcagag tattggagat
    6851  tggagaatgt tctgacactt caacagcttt aagaaggagt tctaagagta
    6901  gagcggaagt agttcagagc aagtcaagct ctaaggttcc aatgtgtgcg
    6951  tatttgaatc aattgaacag tatgcaaatg gtacctctta actatcatga
    7001  ggattccagc tcggatcctt tcaggcgtat gactaacgcc atgagagaat
    7051  tttattatac ccaagaggtc actttatacg aagtgtacca aaaaatggca
    7101  gattactggg ctgatttttc tgcttgtggg tttgacagaa aatactcgaa
    7151  gattgatcaa gacgacaaat tgttcgtctt agacttcaaa ttgcaaaaac
    7201  tcatcggcaa gagtgccaca ctaaacttga aaggggtgta ttcagagtac
    7251  caatttgggt tttgctccga cggtctgatt cctttgacag caatgggtag
    7301  gaagtacgat tattgtttga ttcatgatca attaaagatt ttatcctcca
    7351  acttatttct gtgttcttgt ccaagtcgat tggttaagta taccaattgc
    7401  gacattagaa ttcgagtgta tgaagcacct cctggtgggg gaaaaacata
    7451  tgctttagtt caaacttact gtagaatgat taagaaaaag tcagtgattg
    7501  taatcacggc taataaagaa tcgcagctgg agattgtaag gagggcgaaa
    7551  agcgagctta aaggtaatct taaggaaggc gaaaaccttt ctcttggaga
    7601  tctaaagaag cttaccagca ccatttatac tgttgattct taccttatgc
    7651  atcatattaa tgttaaagga gatattatgc tcgttgatga gtgctttatg
    7701  atgcacgctg gggcagtgac tgcagctttt caattttcac aatgcaagaa
    7751  ggctgcttta tatggggaca gtagacaaat tcactacata cagcgcaatg
    7801  acttgggctg ttctttattg catgatatta atgacttcct ttcggacgaa
    7851  gtcagagtgt acggcgatgt ttcatttagg tgcccatggg atgtatgtga
    7901  gtggttgagc ctaacctatc cagttcatat cagaagtacg aatgaagaca
    7951  gtgtgggtaa gtcaagtatg agagtggtct gcataaattc tgttgaggag
    8001  gtacctgtag accaggatca tgtttacttg acatacaccc aagatgaaaa
    8051  aagggatgtg aggaaacacc ttttgaagag tgttacagat tgccctgttg
    8101  ttttaacagt gcacgaagcg caaggtgcca cttacaaata tgtaaattta
    8151  gtgagagtga aatttcaaga aaatactccc ttttcttctt ataaccacat
    8201  caatgtggcc ttgtctaggc acacagatca cttggtgtat tacgttctgg
    8251  tgaatagatc aatggatgac acggcgtcgg ccattactcg taccaaaaaa
    8301  ctagttgaca gattcagagt ttaccctcaa gaattttcga catccacact
    8351  tcaatggaac atgggggata tgtacgaggg taaagaggag tgtaaagcag
    8401  tttcaacacc ctatcagtgc attaacgatt ttcttgaaga tgtagtagtg
    8451  ggtagtacta cacttgattt tggagacatg tcaagtgaat tatccgatca
    8501  accttttgaa tgtggggttg atggagtgat tataagagag ggcaacaact
    8551  tgcgcaacaa tggggttgcg cagaatccgg ctcgtgttta gctatgtgag
    8601  atctcaagct ataccagatc gcaaggcctc tttacaagag aatctttatt
    8651  cttttgaaag tagaaattat aattttctcg attgtgaaag gttcagtagc
    8701  cctaaacaat ttggaatagc tatggccatg gcggttttaa agtcatgctt
    8751  taacctggag aagttttcta ctcttaagga tgacttgata gccataagtg
    8801  agaagaatat tcttaaatgg cttaagaagc gagatgagtc gagttgtaag
    8851  gctctgatga aggatattga aaagcctttc gacttggaga ctgagatatc
    8901  gaattttaaa ctaatggtta aaaaagaggc aaaggtgaaa cttgatgatt
    8951  cctgcttatc aaagcatcct cctgcgcaga atattatgtt tcataggaag
    9001  gcggtgaacg cgattttttc gccagttttt gatgaattca agaatcgtgt
    9051  tctttattgc ttaaactcga atatagtctt ctttactgag atgacgaatg
    9101  atcatttttc acagattctt cgtaggcttc ttggcgacca agacgtctac
    9151  aacgtcgggg aaatagactt cagcaagttc gataaatctc aagatatttt
    9201  tgttaaagaa tacgaaagaa ctttgtatga agctttcggc attgactctg
    9251  agcttttaaa tgtgtggatg caaggcgagt attctgcgaa agccaccacc
    9301  ttagatggtt ccttaagttt ttctgttgat aatcaaaggc ggtcgggtgg
    9351  ttcaaatact tggattggta attcgctggt cacgcttggt ataatagcat
    9401  tatactatga tgtgagtaag ttcaggcttt tagctatttc aggtgatgac
    9451  tctttaatat attcggataa taaaatagcg aattttgcca ctgaaatttg
    9501  tttggagtcg ggttttgaaa caaaatttat gtctccaagc gttccttatt
    9551  tttgttctaa gtttgttgtt caaactggaa caaacacggt ttttgtacca
    9601  gatccctata aactcatggt gaaacttggt gcttcgaaca agtttgttac
    9651  taatgaaggt ctttttgagg tctacacttc ttttagggat cttaccaaag
    9701  attatggtaa tcaaattgtg ttagagagat tgaaacatct tgtggaaaag
    9751  aagtacaact ttgagtcggg taccacttta ccagctttac aggctctaca
    9801  ttgtttgcga tcgaatttta tgtctttcgc acgtttgttt ccgcgcattt
    9851  cgggttggtg gatggtcgat ccgcgcaact taaaattctt tgtgaaacta
    9901  ccgggaatta taatagagcg tgtaaacgaa gaaagagatt ctaggtattt
    9951  cgtgtcacta ctcgacagcg cggaggcgac cgtcgtaagt caagattgaa
   10001  gcgtcttaga cgagtcttaa gggtattgtg tgttaaagaa gatgtctact
   10051  cttttatctc tgcagaaagt aaacaggttt gtgtgtgtcg tggtgcctga
   10101  ctcttggacg ggtgacgtgt ttggttttaa tgtaaacaag tcccaagcca
   10151  ataagttttc ttatggagac tatgcttaca tttctatgca agaagatctg
   10201  tcgaaatctc acgtgatact gttcgctttt gaggaagaca atatgtatca
   10251  tattaagtat attcagacca tctcttcgtc tataagtgtg tcatctacag
   10301  acgaggtggt gaaagacttt acggtggaag atctttcagc ggttaaattt
   10351  actttacggg ttttaaggga tgagagcatt ctatcgtgcg aagttcacga
   10401  aatgagagtg aaggttaaag ttgggtattc cagttttatt aaatttggca
   10451  ccatttcgta tgttcctcct ggtgaaggtc acatcaatac agtaaaaccc
   10501  tcttttcagt tcgtttttga caccttgcgg agtgacttgt cgagcgagac
   10551  tgtgatagtg gaaagtggtt gtcccactgc aactgcgtgt tcgcttacgc
   10601  ctgctaaatc ccctttttcg caaggggccc tttttgagga attagaagcg
   10651  tcggaatctt atcgtgatca tgaagagaag atttacaggt gtttgagagc
   10701  ttcgtcaatg gtttctttta ttatctgttt cggtctcgtc atcgctgtgg
   10751  tagtggtttt aatcatgaat tctcagaatc atggttgagt attacgatga
   10801  actgttacga gagatctgac ttagacctac ttttaggttg tgctacctgt
   10851  gcgataatag tcttcttagt ttttatttgt atgtacgcgt acagcacacg
   10901  cccaactttc aataaaccgt ctgtatcacg ctctagagcg ggtaatagcg
   10951  actttcaacc accagtgtcc agttacgcta ctatctcata gtttgatcat
   11001  ggtggttttt ggtttggatt ttggaaccac attttgcacg ttgtcggttt
   11051  gttgctctaa ggagattgta ttacttaaac aaaacgggta tagtttcatt
   11101  cctacgacaa tttttctctg cttagacgat acggttcttt atggttatga
   11151  tgcagattac gctcatgcga gtggttggtc ggggttttac tataaagatt
   11201  taaaacgctg ggttggctgc actgataaaa acttttatac ttatatggat
   11251  aaactcaagc ctgattacga agcaaggctt tctttagtag gtaaagggac
   11301  tttaaaaact gtagaattgc cttcgttgtc taacacgaaa aggtatatac
   11351  ctttaccaga acttatagca ttgtatacta aatgcatcgt gaaggacgca
   11401  gagagagcgt ttacactgac atgtacaggg gtaatatgtt cggttccggc
   11451  tgggtacaat acgattcagc gtgcttttac agaacaaagt ataagccgta
   11501  gtggttttcc ttgtgtgtac atgcttaatg aaccttccgc cgctgctttg
   11551  gcgtcggcac ccatgcttaa atctgaagat aagcgtttgc tcatttatga
   11601  tttcggtggg ggtacattcg acgtttctgc cgtaacagtt gaaggcgcaa
   11651  catttgtagt taaatcatca gcgggagata tgaatttggg cggtcgcgac
   11701  atcgacttag ctttgtctaa ttttcttaag aaattagcta aatcggatta
   11751  tgtcggtgaa ctagctgtta ctagtttaaa ggagggttta agtatggctg
   11801  aaggcaaaat caagtattta gtaccgtcaa gcaacggaga tgtggaagta
   11851  gtggtatcaa cttctatgtt gaatgagatt tgttctccgt ttataaagag
   11901  gactttgaag atagtagaga aagtgcgtga aaaggctcgt ttttctgcag
   11951  aacatggtgc gaaagttgtg gtcgttggtg gttcatcaac gttacctggg
   12001  ttatgcgatg agcttaacgc agttcatggg atatctgggc tggttcgtct
   12051  actagatcac agggctgcgg tgtcgtacgg atgtgcatta tatgctaaat
   12101  gcttgacaag cgccagtaac gttttaatgg tagattgtgc tacttctaat
   12151  atatgcttac ccggaacttg tgccgactgt atagttgtta taccatctgg
   12201  agcaccgatt ccttttgatg gtgaaaggac catacacata aacaatgcgt
   12251  ctataaactc gtattacgat gcaagattgt ttgagggtaa ctacacgaag
   12301  gctccgagaa atgagttgat atactcgagc agagttttgc ttaaagattt
   12351  aggtttgaat aatcggcaac ttaccacggt gacagtaaaa cttcacacaa
   12401  aaattgactc ggtcggtaag attacctatg acattacagg tccatctggg
   12451  gtgagaaagt cggtagtggg tttaccgcat tacgattttt ctaatatttc
   12501  agttggtttt ggctacaaaa taaaatatct tagtgataca aatcgcaacg
   12551  ctgcggcttt gattttgtgt gtcactttag atcctgaagc tcgagcatcg
   12601  tactcttttc ataaagaaga ctacttgtgc gaaattaacg acgctaaacc
   12651  tttagagact tatagaagca aatacgatgt cgcaagttcc tataggatct
   12701  cggaatctag gtcacgaatg gggaaggctg ttcaaaaaat tttacgggga
   12751  gccgctgtgg agagattacc tctctagaag cgctggatct tatagacctg
   12801  aattactgaa ggaaggttat atgagcgcgg atgggaaatt cattactagc
   12851  gaggagttag caaaagcgga aactgggtca gttaggcacg agttggctat
   12901  tctcatttac tctgattcta tttataaatg gagtgatatt tgtggatcta
   12951  caccacgtag tatatttgaa ggggtagctg gtatgagtct acctaatggt
   13001  gaatttttgg aagtggatac gatgcgcact ggatgtaaat tcgacataga
   13051  cgtggtgaaa gggttcttaa actatgatga aatggaaaag gatagcgaga
   13101  aagaactgca tgcagagcac acgtgggcgt taagtaacgc cacgggtacg
   13151  cttatggacg ccagccatgt ggaaaaattt aaaacgatac tttttaaaga
   13201  taacacgaat ttagatatta cggacaatat acataacgtt tatggagact
   13251  atctttcgta tcttatagaa ttgtacaagc gtcacgtgat aatctcacac
   13301  gatgaactaa atttgaggcg tgatttcatt agttacgtta tagattatct
   13351  taacgcttac gatttcggtt acgcagatta ttctgacaat ccgttaatca
   13401  caggatttct acttgacttc atgattcata atcgtgtata cacatcgacg
   13451  tactcggtaa atttgagtaa ccttagatta tttatatcta aagttttacc
   13501  tgttatgctc gatacgtggg tgatcgctac tcctaagata attaaggatg
   13551  agcgcttatg tattccgata tcagcggtgg aattagtgag ttcattaccc
   13601  tcgcttaact tatatgatag gaccgtgttg gttggcgaca agttaatgtc
   13651  tttggagtat cgtttcgaat acgaggctat tgaatccatg gtggataaag
   13701  ttaaggctac gttgttggaa tcaaataagt tgagtggagt cagcgagtta
   13751  cacctatttg acacttttta cgtttattat gcagtgtttt gtaccgcaaa
   13801  agaacgtacg atacgcaggc ccgctcaata catgttatac aagggtgaaa
   13851  gtgtgtctat ggaagaagta gaagatcttt tcgattcact acagaaggcg
   13901  tcgtatgacg ttaatgttag gaggtgtgtc ttaggagcta tgggtgatag
   13951  aggttttgaa tgttacaagc gtttagggtt acgctttccg cctaaatcag
   14001  attatgtagt gccagatcat atggcgtacc taaacgtaga tttttataag
   14051  cagcttgatg aaagtgtgct tactcctgaa gaatcccatc acttaagtaa
   14101  tataagacgg agggtagacg taaagtgtaa caatttggtg tcccttaaga
   14151  aaacggtttt taaggattcg tcttctagct tttcgaatgt agtaaagtat
   14201  cctaacagtg cgagaacgaa gaaggtggct tacagtagaa ttccgcgctc
   14251  tgtgcgaaat aacggttcca tttaacatta cactatttga tatacttgtt
   14301  ctgatggcgc tggttaatag cgaagttagc gctttacaat caaatgaatt
   14351  gtctaccaat aataatgcca ttcctaattc gttggattct gttttagtat
   14401  tgagttctat aagcgagtcg tctatagatc attacacttc agaggaaatc
   14451  cctaaagttt taaacgatct tcagactttt ctgataacta agtactcgat
   14501  tagaccagaa catatattaa gtcacgctgc tatgatagtc aaaagagctg
   14551  caaccatatc tacaagcatg gaagcacgtt tggttccagg aagtcacata
   14601  tcgtacgacc tcaagacgtc agacgggacg gttttgcact ataagctcga
   14651  agatacggtc gtttttggtt acataaggac gtggaaagac gaagtgtcta
   14701  atcctaatcc tgtgagaaag ttgcgctgca ctcttgaaat tctacacgaa
   14751  tggctggcgc ataaacgccc tgagatttat gaaactaaga gaacgactaa
   14801  gttgggttta cctaaaggca aagcttactt gggcgctgat tttctcagtg
   14851  gcaacgtttc cactctcagc gaacacgata gggcgatttt actgcgaagt
   14901  tcagaagttg ccctgaatcg tccgtcgaaa tctcctaaag tctcgctgac
   14951  gagtttatat gacatggtta aagagtttta agtacacaga tggtacttta
   15001  tagctccgct gtgtggaact tattaagaca ttgtgatatt actaattttg
   15051  tacaaaaatg cctgaagtaa gatatagcga cattaccggt ttgtctgttg
   15101  gcaattcaac agcaactaat actgccgacg ccgctttggt ggcaaaggac
   15151  attttagcta aggtcaagga aactaatcca actctaaccg atgatcattt
   15201  gaacttgatc tggggcgtcg tattgctcag acttgctgtt cgtactacgt
   15251  ctgagaagtc tttagggttc gaagaaacca cctttaaaat aggagatgtg
   15301  gaatacaaaa taaaggatga agattttgta aatgttgtcg ataaacacgt
   15351  gaaaaccagg tttgaaaaga accctctgag acactgggct cgaggttcta
   15401  atgctgctta cttggatata gcgaggaaaa caccgaacga gattatgtct
   15451  gctagggctt tgaagtgtgg tctacctaaa gatgtgggct atttgtgcgc
   15501  cgattttctc gtgggtagcg gtttgtcaga ttttgagaga acttgttacc
   15551  ttcaagcaca gaatcatatg ttagcagaaa aagctggcat tccagccact
   15601  ggaactctta cgactatagc caacttaggg tattataaag cttgagagta
   15651  aacatggaat taattcaaca tcctacggat gtgagaatgt ctcgtcctga
   15701  acggttaaat tttacgactt acatctggaa tgacggtgtt ttaaatctct
   15751  tggtttgtaa agacattaag catgctagcg atcttgttcc ctatagtaat
   15801  tgttgtataa ttagtaaaac tggttatttg tgtaatgatg gtttttctta
   15851  cgttgttggg gcacctgaaa ctaacttact ttatgatctt ttagacaagc
   15901  ttaagaagca accaaaaatg gaattctttc ccttttcgtt actatgtaca
   15951  gcaacgttta atcagaatag agtgttattt tcgaacgaat ctaggttggt
   16001  cgcttttctt aagaatggta agcgtatgga atttactaac agttacgaac
   16051  cgacaactac tatagtaata tatcagggtg atactgatat gtttactagc
   16101  agtagttttg aaggtgattt acttagctgt atgcttaaag cctttccagt
   16151  tggggcttat aagaacgttc atttcttttc tgattagctc agctttcaga
   16201  agctcattta gtatatcacg ataattactg attcatatca tcatgagagg
   16251  atattatgac gtgcaagctt ttaaggacct caacaatcac tacgtttcat
   16301  gtattcacgt tgtgggagct gttgaacggc gtaccgatgg actcaagcaa
   16351  cattgcttag agtttaataa tagcttagca atcaaagcag cgctgaagtg
   16401  cgatgctaat tctgatgtga tgtcgcggaa aaactccgcg aaggaaaaac
   16451  tagaaatttt gactgaaatt gacgcgaact gcgccattct gttaaaactt
   16501  cttaggaaaa aagttgtcag gtatgaacta ggagtgagga gcatgcaagg
   16551  tacttttgat tatatatatc aaaaatactc ttctctacat cccgaagtac
   16601  ctcatagtga gatcttaagg cacaagatca cacctgcagc tcaagaagtc
   16651  attgaagctc tttcggagga gtacaagttg tctctctccg acaggagctt
   16701  tcctggattc ttagtacttg gtgtaagtac tggtactaat aggctgtctt
   16751  ttgctacagc cgcagatcaa gcggatctag tcacggaaaa cgacgatttc
   16801  gttaacgtcc gtatggagtc ttgataaaga aaatttaatt aactctgtac
   16851  ttgagttata ggataagtac aaaggaaagg gggaaaataa acctaacgct
   16901  ccctattagt ctaaactgcc actgcgtggt tgcttcaaat aataagtttg
   16951  aactgttaag tgtgaactaa taaactgtga ttataaaagt ggagtactaa
   17001  agtacccact acctttaatc acagacaata aaggtccat