Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate SL10 coat protein gene, complete cds.

ACC No: DQ911147

Dated: 2006-09-25 | Length: 597 | CRC: -1706046030

                
ID   DQ911147; SV 1; linear; genomic RNA; STD; VRL; 597 BP.
XX
AC   DQ911147;
XX
DT   25-SEP-2006 (Rel. 89, Created)
DT   25-SEP-2006 (Rel. 89, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate SL10 coat protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-597
RA   Wang J., Xi D., Lin H., Feng H., Lan L., Du J.;
RT   "Molecular detection of four viruses mixed infecting vitis";
RL   Unpublished.
XX
RN   [2]
RP   1-597
RA   Wang J., Xi D., Lin H., Feng H., Lan L., Du J.;
RT   ;
RL   Submitted (19-AUG-2006) to the EMBL/GenBank/DDBJ databases.
RL   College of Life Science, Sichuan University, 24 South Section 1, Yihuan
RL   Road, Chengdu, Sichuan 610065, P.R. China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .597
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /specific_host="vitis"
FT                   /isolate="SL10"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /db_xref="taxon:64003"
FT   CDS             1. .597
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ABI84368.1"
FT                   /translation="MELMSDSNLSNLVITDASSLNGVDKKLLSAEVVKMLVQKGAPNEG
FT                   IEVVFGLLLYALAARTTSPKVQRADSDVIFSNSFGERNVVVTEGDLKKVLDGCAPLTRF
FT                   TNKLRTFGRTFTEAYVDFCIAYKHKLPQLNAAAELGIPGEDSYLAADFLGTCPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
XX
SQ   Sequence 597 BP; 158 A; 120 C; 163 G; 156 T; 0 other;

dq911147 Length: 597  25-SEP-2006  Type: N  Check: 1303  ..

       1  atggagttga tgtctgatag caaccttagc aacctggtga taaccgacgc
      51  ctctagtcta aatggtgtcg acaagaaact tttatctgct gaagttgtga
     101  aaatgttggt gcagaaaggg gctcctaacg agggtataga agtggtgttc
     151  ggtctactcc tttacgcact cgcggcaaga accacgtctc ctaaggttca
     201  gcgcgctgat tcagacgtta tattttcaaa tagtttcgga gagaggaatg
     251  tggtagtgac agagggtgac cttaagaagg tgctcgacgg gtgtgcgcct
     301  ctcactaggt tcactaataa acttagaacg ttcggtcgca ctttcactga
     351  ggcttacgtt gacttttgta tcgcgtataa gcacaagtta ccccaactca
     401  acgccgcggc ggaattgggg atcccaggtg aagattcgta cttagctgca
     451  gattttctgg gtacttgccc gaagctctct gaattgcagc aaagtaggaa
     501  gatgttcgcg agtatgtacg ctctaaaaac tgaaggtgga gtggtaaata
     551  caccagtgag caatctgcgt cagctgggta gaagggaagt tatgtaa