Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate PV124 major coat protein gene, complete cds.

ACC No: EF012717

Dated: 2007-04-20 | Length: 597 | CRC: -1790883552

                
ID   EF012717; SV 1; linear; genomic RNA; STD; VRL; 597 BP.
XX
AC   EF012717;
XX
DT   20-APR-2007 (Rel. 91, Created)
DT   20-APR-2007 (Rel. 91, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate PV124 major coat protein
DE   gene, complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-597
RX   PUBMED; 17223202.
RA   Beuve M., Sempe L., Lemaire O.;
RT   "A sensitive one-step real-time RT-PCR method for detecting Grapevine
RT   leafroll-associated virus 2 variants in grapevine";
RL   J. Virol. Methods 141(2):117-124(2007).
XX
RN   [2]
RP   1-597
RA   Beuve M., Sempe L., Lemaire O.;
RT   ;
RL   Submitted (20-SEP-2006) to the EMBL/GenBank/DDBJ databases.
RL   Virology, INRA, 28 rue de Herrlisheim, Colmar 68021, France
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .597
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /specific_host="Vitis vinifera cv. Negro Amaro"
FT                   /isolate="PV124"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy"
FT                   /isolation_source="leaves; wood"
FT                   /db_xref="taxon:64003"
FT   CDS             1. .597
FT                   /codon_start=1
FT                   /product="major coat protein"
FT                   /note="ORF6; 22 kDa"
FT                   /protein_id="ABK59995.1"
FT                   /translation="MELMSEENLSNLVITDASSLNGVDKKQLAAEVIKMLIEKGAPQEG
FT                   VEVVFGLLLYALAARTTSPKVQRSESDVILSNRFGERTVVVTEGDLKKVLENFPALAKY
FT                   TNKMRTFGRTFTEAYIDFCVAYGSKMPQLNAAVKLGIPADDSYLAADFLGACAKLSELQ
FT                   QSRKMFASMYALKTEGGSVNVPVSNLRQLGRREVL"
XX
SQ   Sequence 597 BP; 176 A; 126 C; 145 G; 150 T; 0 other;

ef012717 Length: 597  20-APR-2007  Type: N  Check: 2514  ..

       1  atggaactaa tgtccgaaga gaatctgagc aacctagtca ttaccgacgc
      51  ctcaagcttg aatggtgtcg ataaaaagca gctagcagct gaagtaatta
     101  aaatgctaat tgaaaagggt gcacctcagg aaggtgttga agtggtgttt
     151  ggtttgctac tttatgctct agccgcaagg accacttccc caaaagttca
     201  acgatcggaa tctgacgtga ttctctccaa cagattcggt gagagaactg
     251  ttgtcgtcac tgagggcgat ttaaaaaagg tactcgagaa ctttcccgct
     301  ctcgctaaat atactaataa aatgcgaaca ttcggccgta ccttcactga
     351  agcttacatc gatttctgcg tagcttacgg aagcaagatg cctcagctca
     401  acgccgcagt taaactagga ataccagcag atgattctta tctagcggca
     451  gacttcttgg gtgcttgtgc aaagctctct gaactgcagc aaagtagaaa
     501  gatgtttgct agcatgtatg ctctcaagac tgaaggtggc agcgtgaacg
     551  taccagtgag taacctgcgc caattgggta gaagggaagt gttataa