Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate PV44 major coat protein gene, complete cds.

ACC No: EF012718

Dated: 2007-04-20 | Length: 597 | CRC: 1366263477

                
ID   EF012718; SV 1; linear; genomic RNA; STD; VRL; 597 BP.
XX
AC   EF012718;
XX
DT   20-APR-2007 (Rel. 91, Created)
DT   20-APR-2007 (Rel. 91, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate PV44 major coat protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-597
RX   PUBMED; 17223202.
RA   Beuve M., Sempe L., Lemaire O.;
RT   "A sensitive one-step real-time RT-PCR method for detecting Grapevine
RT   leafroll-associated virus 2 variants in grapevine";
RL   J. Virol. Methods 141(2):117-124(2007).
XX
RN   [2]
RP   1-597
RA   Beuve M., Sempe L., Lemaire O.;
RT   ;
RL   Submitted (20-SEP-2006) to the EMBL/GenBank/DDBJ databases.
RL   Virology, INRA, 28 rue de Herrlisheim, Colmar 68021, France
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .597
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /specific_host="Vitis vinifera cv. Chardonnay"
FT                   /isolate="PV44"
FT                   /mol_type="genomic RNA"
FT                   /country="France"
FT                   /isolation_source="leaves; wood"
FT                   /db_xref="taxon:64003"
FT   CDS             1. .597
FT                   /codon_start=1
FT                   /product="major coat protein"
FT                   /note="ORF6; 22 kDa"
FT                   /protein_id="ABK59996.1"
FT                   /translation="MELMSDENLSTLVITDASSLNGVDKKSLSAELIKMLVQKGAPAEG
FT                   IEVIFGMMLYAIAARTTSPKVQRGDSDVLFSYGAGDRTITVTEGDLKKVLDGFAPLTRF
FT                   TNKLRTMGRTFTEAYIDFCVAYKHKMPQLNAAAELGIPAEDSYLAADFLGACPKLSELQ
FT                   QSRKMFASMYALKTEGGVVSTPVSNLRQLGRREVM"
XX
SQ   Sequence 597 BP; 164 A; 121 C; 159 G; 153 T; 0 other;

ef012718 Length: 597  20-APR-2007  Type: N  Check: 8631  ..

       1  atggagctaa tgtctgatga gaatttaagt actcttgtca taaccgatgc
      51  ctctagctta aatggcgtcg ataagaagtc actgtccgca gaacttataa
     101  aaatgctcgt gcagaaggga gctcccgctg aaggtataga ggtgatcttc
     151  gggatgatgc tatatgccat cgcagcgaga actacatcgc ctaaagttca
     201  aaggggcgat tctgatgtgt tattctcgta cggtgctgga gatagaacta
     251  ttactgttac tgaaggggat cttaagaagg tgcttgacgg atttgcacct
     301  cttactaggt tcactaacaa acttcgaact atgggtcgca ctttcacaga
     351  agcgtatatt gatttctgcg tggcgtacaa gcacaagatg cctcagctca
     401  acgcagccgc agagttgggg ataccggctg aagattctta ccttgcagcg
     451  gattttctgg gagcatgtcc gaaactctct gaactgcagc aaagcagaaa
     501  aatgttcgcg agtatgtacg ctctgaagac tgaaggtggg gtggtaagta
     551  cacccgtcag caatctacgc caattgggta ggagggaagt tatgtga