Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate PG11 heat shock protein 70, heat shock protein 90, minor coat protein, major coat protein, and P19 genes, complete cds.

ACC No: EF012720

Dated: 2007-04-20 | Length: 5148 | CRC: -1087779059

                
ID   EF012720; SV 1; linear; genomic RNA; STD; VRL; 5148 BP.
XX
AC   EF012720;
XX
DT   20-APR-2007 (Rel. 91, Created)
DT   20-APR-2007 (Rel. 91, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate PG11 heat shock protein 70,
DE   heat shock protein 90, minor coat protein, major coat protein, and P19
DE   genes, complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-5148
RX   PUBMED; 17223202.
RA   Beuve M., Sempe L., Lemaire O.;
RT   "A sensitive one-step real-time RT-PCR method for detecting Grapevine
RT   leafroll-associated virus 2 variants in grapevine";
RL   J. Virol. Methods 141(2):117-124(2007).
XX
RN   [2]
RP   1-5148
RA   Beuve M., Lemaire O.;
RT   ;
RL   Submitted (20-SEP-2006) to the EMBL/GenBank/DDBJ databases.
RL   Virology, INRA, 28 rue de Herrlisheim, Colmar 68021, France
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5148
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /specific_host="Vitis vinifera cv. Petit-Meslier"
FT                   /isolate="PG11"
FT                   /mol_type="genomic RNA"
FT                   /country="France"
FT                   /isolation_source="leaves; wood"
FT                   /db_xref="taxon:64003"
FT   CDS             1. .1800
FT                   /codon_start=1
FT                   /product="heat shock protein 70"
FT                   /note="HSP70; ORF3"
FT                   /protein_id="ABK59998.1"
FT                   /translation="MVVFGLDFGTTFSTVCVYKDGKVYSFKQNNSAYIPTYLYLFSEAN
FT                   HMVFGYEAESLMHNANVKGSFFRDLKRWVGCDSSNFDDYYDRLKPHYTVRPQKIGTGLN
FT                   DTVIIGNYGGTVRSEVHLPGLIASFIKAIIGCAENAFACACTGVICSVPANYDSVQRNF
FT                   TDQCVSLSGYQCVYMVNEPSAAALSACNLINRKSANLAVYDFGGGTFDVSIISYRNNTF
FT                   VVRASGGDLNLGGRDVDKAFLKHLFSLTSLEPDLSLDISNLKESLSKTDAEIVYTLKGL
FT                   DDKREDVRVNKEILTTVMLPYVNRTLNILEATLKSYAKNMGGLRNVKCDLVLIGGSSYL
FT                   PGLEDILSKHRRIDRVLKVADPRAAVAVGCALYSSCLSGSQGLLLVDCAAHTIAIAGMS
FT                   CDQIICAPAGAPIPFSGTTPLYLARANRNSQRQVAVFEGEYVKCPKNRKICGSNIKFFD
FT                   IGVTSVSYSPITFYLDVGISSVGAISFVVRGPEGKEISLTGTPAYNFSSVVLGTRSVRE
FT                   LHISLSNKVHLGLLLHRKADRRLLFSESEAFRYVETVEVADVLKEFKSYTASSLPLDED
FT                   VEPLMGKSVQKVLRGGRLEEIPL"
FT   CDS             1727. .3331
FT                   /codon_start=1
FT                   /product="heat shock protein 90"
FT                   /note="HSP90; ORF4"
FT                   /protein_id="ABK59999.1"
FT                   /translation="MSNHSWGSLFKKFYGEADWKKYLSRSIVVHTTSVKNLPDAQLYGG
FT                   RIVKKSDFESAAPRSFEQELGLLTLCEREVGWSKMCGISVEEAMYQLTNPEAYPVTAEK
FT                   CDPDVKTEGQKYTMDDVVNFMRSSKLDVDDKVLAEQCWSLSNSCGVLINPDDKERFVAL
FT                   TFKNNELVNDSSNANIDCRVSDYLVYAMSLFNSRTQKSQAGNVSLYERYCAYIRTYLES
FT                   TDLYFTSPNRIPLLTGILYDFCKEYNVFYSTYKRNVDNFRFFLTNYMPLISDIFVFQWV
FT                   KPAPDVRLLFDISAAELTLEVPKLSLIDSQVVIGHVLRFVESYTADPAIEALEEKLDAI
FT                   MKMSNPHLSTAQLWVGFFCYYGEFRTAQRRVVRRPDVYEVPESVGRFEINMKDVEAFFD
FT                   KMQREVPDVSLRRQFNGAKAYEAFKVFKKGKISFKPISRLNVPREFWYLNVDYFRHANR
FT                   SGLSEEEVLILNNISIDVRKLCAERASSTLPSAKRFSKSHKSSVPSLRQERKVRDPLIT
FT                   LRNSLYEFRHRDRDRRV"
FT   CDS             3294. .3965
FT                   /codon_start=1
FT                   /product="minor coat protein"
FT                   /note="CPd; ORF5"
FT                   /protein_id="ABK60000.1"
FT                   /translation="MSSGTGIAIGGSEAVETSGFVLSTRKEAVDKFFNELKNENYSSVD
FT                   SSRLSDQEVKEVLEKSKESFKSELASTDDHFVYHIIFFLIRCAIVSTSDKVKYVGSHKY
FT                   VVEGKTYTVLDAWVFNMIKGLTKQYKRVNGLRAFCCACEDLYLTVAPVMSERFKTKAIG
FT                   MKGLPVGKEYLGADFLSGTSKLMSDHDRAVSIISAKNAVDRSAFTGGERKIVSLYDLGR
FT                   N"
FT   CDS             4050. .4646
FT                   /codon_start=1
FT                   /product="major coat protein"
FT                   /note="CP; ORF6; 19 kDa"
FT                   /protein_id="ABK60001.1"
FT                   /translation="MDLMSDDNLSGLVITDASSLNGVDKKLLSAEVIKMLIQKGAPSEG
FT                   IEVVFGLLLYALAARTTSPKVQRADSDIIFQNTYGDKTVIVTEADLKKVLEGCAPLSRF
FT                   TNKHRTFGRTFTEAYIDFCVAYKHKLPQLNAAAELGIPAEDSFLAADFLGACPKLSELQ
FT                   QSRKMFASVYALKTEGGIVNTPVSNLRQLGRREVM"
FT   CDS             4646. .5131
FT                   /codon_start=1
FT                   /product="P19"
FT                   /note="19 kDa protein; ORF7"
FT                   /protein_id="ABK60002.1"
FT                   /translation="MEICAQSSESLVLLRTNQNTILLIIKSDDNVHLPKIIICGYLRVS
FT                   HRGDVTGCCREDIIKDFEGAHHTVIRSKTIHYDYESAFKEYNDADCVVKFFLETGDVFW
FT                   FFLRSDSKGRSARHLRTFFEANNFFFGSHCGTMEYCLKQVLIETESVIDSFCEERNR"
XX
SQ   Sequence 5148 BP; 1443 A; 999 C; 1280 G; 1426 T; 0 other;

ef012720 Length: 5148  20-APR-2007  Type: N  Check: 1824  ..

       1  atggttgttt tcgggttgga ttttggcaca accttttcga cggtttgcgt
      51  ctacaaggat ggcaaggtgt attcctttaa acaaaacaat tctgcgtata
     101  ttccgacgta cctctacctc ttttccgaag ctaatcacat ggtttttggt
     151  tatgaagccg agtcactgat gcataatgct aatgtgaaag gctctttctt
     201  cagggattta aaacgctggg tgggatgtga ttccagtaac tttgatgact
     251  actacgatcg tttgaagcct cactacacgg ttcgcccgca aaaaataggc
     301  actggtttaa atgacacggt gattattggg aattacgggg gtactgtgcg
     351  ttctgaggtg catttgcccg gactaatagc ttccttcatc aaggcgatca
     401  ttggttgcgc cgaaaatgct ttcgcttgtg cttgcacagg agtaatatgt
     451  tcggtgccgg caaattatga tagcgttcag aggaacttca ctgatcagtg
     501  cgtatcctta agcggttacc aatgcgtgta catggtcaac gaaccttccg
     551  cagccgcttt atcggcatgt aatttgataa ataggaagtc ggcgaatttg
     601  gctgtatatg atttcggcgg tgggaccttt gacgtgtcta ttatttccta
     651  ccgcaacaat acgttcgtgg tgcgcgcttc cggaggagat ttgaatttag
     701  gaggaagaga cgttgataag gcttttttaa agcatctttt ctccttgaca
     751  tctctagaac cagatttgtc gctggacata tcaaatctaa aggaatcgtt
     801  atctaaaacc gacgccgaaa tagtttacac gttaaaagga ctcgatgata
     851  aaagggagga cgttagagtg aataaggaaa ttctcaccac agtcatgctc
     901  ccatacgtta atagaacttt gaacatcttg gaagccacac ttaaatcgta
     951  cgccaagaat atgggcggat tacgcaatgt taaatgtgac ttggttttaa
    1001  tcggtggttc ctcatacctt ccgggtttgg aagatatctt atcgaagcat
    1051  cgacggattg atcgagtact gaaagtcgcc gacccacgag cggcagttgc
    1101  ggttggttgc gcactttact cgtcgtgcct ctcgggttca caagggctac
    1151  tactggtaga ttgcgcggct catactatcg ctatagccgg tatgagctgt
    1201  gaccagatta tttgtgctcc agcgggagct cccatcccgt tctcgggtac
    1251  aacacctttg tacttagcaa gagctaatag aaattcacaa cgtcaagttg
    1301  ctgtattcga aggtgagtac gtgaaatgtc ccaaaaacag gaaaatctgt
    1351  ggttcaaata taaaattttt tgatatcggt gttacgagcg tctcgtactc
    1401  acccatcact ttctatttag atgtaggcat atccagtgtg ggagccattt
    1451  cctttgtggt gagaggtccc gaaggaaagg aaatttcctt gacgggcact
    1501  cccgcttaca acttttcttc ggtggttctc gggacacgta gtgtccgaga
    1551  gttgcatatt agtctaagca ataaggttca tctcggtctg ctcctacacc
    1601  gaaaggcgga tcggcggtta cttttttccg aaagcgaagc gtttcgctac
    1651  gttgaaacgg tagaagttgc agatgtatta aaggaattta agagttacac
    1701  cgctagttct ctaccgctgg acgaggatgt cgaaccactc atggggaagt
    1751  ctgttcaaaa agttctacgg ggaggcagat tggaagaaat acctctctag
    1801  gagcattgtg gttcacacca ccagcgttaa gaacttgccg gacgctcagt
    1851  tgtacggcgg tagaattgtg aagaaatccg actttgaatc cgcagcaccg
    1901  agatcattcg agcaggaact ggggttattg acgttatgtg aacgggaagt
    1951  aggctggagt aaaatgtgcg ggatatccgt agaggaggcg atgtaccaac
    2001  tcacgaaccc cgaagcatat ccagtcactg ctgaaaaatg tgatccggac
    2051  gttaagactg aagggcagaa atatacgatg gatgacgtgg tgaatttcat
    2101  gcgctcatct aaattagacg tagatgataa agttttagcg gaacagtgct
    2151  ggtctctatc caactcatgc ggggttctaa ttaatcctga cgataaggaa
    2201  agattcgtgg ccctcacgtt taaaaacaat gaattggtta atgactcaag
    2251  caacgcgaac atagattgtc gcgtgagtga ttacttagtt tacgctatgt
    2301  cccttttcaa ttctagaact caaaagtcgc aagcgggtaa cgtttcgctc
    2351  tatgaaaggt attgcgctta catcagaact tacttggaaa gcactgactt
    2401  gtacttcacc tctcccaaca ggataccgtt gcttactggt attctctatg
    2451  acttttgcaa ggagtacaat gttttttact ccacgtacaa gcgaaatgtc
    2501  gataacttca ggttcttcct aacaaattat atgccattaa tttcggatat
    2551  atttgtcttc cagtgggtga aaccggctcc agacgttcga ttattgttcg
    2601  atataagcgc ggccgaactg actttggaag ttccgaagtt aagtttaata
    2651  gattcgcagg tggtgatagg acacgtcctg aggtttgtcg aatcgtacac
    2701  agctgatccg gctatcgaag cgttggaaga gaaattggat gccataatga
    2751  agatgagtaa tcctcatcta tcaacggcac aattgtgggt gggatttttc
    2801  tgttattacg gtgaatttcg taccgcgcaa cgtcgagtgg tgcggagacc
    2851  agacgtgtat gaggtgcctg agtcggtcgg aaggttcgaa attaacatga
    2901  aagatgtcga agcgtttttt gataagatgc aacgagaagt accagatgtg
    2951  tctttacggc gacaattcaa tggggccaaa gcgtatgaag catttaaagt
    3001  gtttaaaaag gggaagatta gtttcaaacc tatctctcgc ttaaacgtac
    3051  caagggaatt ctggtatctg aatgtggatt actttagaca tgcgaataga
    3101  agcgggttga gcgaagaaga ggtgctcatt ctgaataata taagcataga
    3151  tgttcgaaaa ttgtgtgctg aaagagcgag cagcactctg cctagcgcaa
    3201  agcgctttag caaaagtcat aaaagtagcg tgccatcgtt gcgtcaagag
    3251  cgtaaagtta gagatccgtt gattacatta aggaattcct tatatgagtt
    3301  ccggcacagg gatcgcgata ggagggtctg aggctgtgga gacctcaggt
    3351  ttcgtgctat ctacgcgaaa agaagctgtc gacaagttct ttaatgaact
    3401  aaagaacgaa aactattcct cggtcgacag cagtcggttg agcgaccaag
    3451  aggtaaaaga agttttagag aaaagcaaag aaagcttcaa gagtgaactg
    3501  gcgtctaccg atgatcactt tgtttaccac attatcttct ttctgattcg
    3551  atgcgccatc gtatccacaa gcgataaggt gaaatacgtt ggaagccaca
    3601  aatatgtagt cgaaggaaaa acttacactg ttctcgacgc gtgggttttc
    3651  aacatgatta aggggctgac aaagcagtac aaaagagtga atggtttgcg
    3701  cgccttttgt tgcgcctgcg aagatttata cttgacagtc gcacccgtaa
    3751  tgtcggaacg tttcaagact aaagctatcg gtatgaaggg cttacccgtt
    3801  ggaaaggaat acttaggagc ggactttctc tcaggaacga gtaaattaat
    3851  gagcgatcat gatagagcgg tgtctataat ctcggctaag aacgctgtgg
    3901  atcgtagcgc ttttactggt ggggagagaa agatagttag tttgtatgac
    3951  ttaggaagga actaagcacg ttgtgcaata gcacgcgtca taatattaag
    4001  tactagtgca taacaaagca gtagcgttta aactgtggtg atagagataa
    4051  tggatttaat gtctgacgac aacttaagcg gtctcgtcat aaccgacgcc
    4101  tctagtctga atggtgtcga taagaaactg ctgtccgcgg aggtcataaa
    4151  gatgctcata cagaaggggg cgcctagtga aggtatcgaa gtagtcttcg
    4201  gattgttgct ttacgctctc gcagcaagaa ccacgtcgcc caaagttcaa
    4251  agggctgact ctgatattat ttttcagaac acttatggag ataaaaccgt
    4301  catcgtaacg gaggctgatc tcaagaaagt gctcgaagga tgtgcacctc
    4351  ttagtaggtt tactaacaaa catcgaactt tcggtcgcac gttcacggaa
    4401  gcctatattg atttctgcgt ggcttacaaa cataagctac ctcaactcaa
    4451  cgcggccgcg gaattgggga taccagcaga agattcattc ttagctgcgg
    4501  actttttggg tgcttgtccg aaactctctg aattacagca aagtagaaaa
    4551  atgtttgcga gtgtttatgc tctgaaaact gagggtggaa tagtgaatac
    4601  acccgttagc aatttgcgcc aactgggtag gagagaagtt atgtgatgga
    4651  aatttgtgct caaagttccg agtcactagt gctattacgc acgaatcaaa
    4701  atacgattct attaatcatc aagtcagatg acaatgttca cttacccaaa
    4751  ataataatat gcgggtactt acgcgtgtcg catcgtggag atgtgacagg
    4801  ttgctgtcgc gaggacataa taaaggattt cgaaggagcg catcatactg
    4851  tcattcgctc gaaaacgata cattatgatt acgaatccgc gtttaaagaa
    4901  tataacgacg ctgattgcgt agtgaaattc tttttggaga ctggagatgt
    4951  cttttggttt tttctccgaa gcgatagcaa aggaagatcg gcgcgacatt
    5001  tgcgtacttt cttcgaagct aacaatttct tctttggatc gcattgcggt
    5051  accatggagt attgtttgaa gcaggtactg atagaaactg agtctgtaat
    5101  cgattctttt tgtgaggaaa gaaatcgtta agatgagggt gattgtat