Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate PV20 heat shock protein 70, heat shock protein 90, minor coat protein, and major coat protein genes, complete cds; and P19 gene, partial cds.

ACC No: EF012721

Dated: 2007-04-20 | Length: 4966 | CRC: -181490803

                
ID   EF012721; SV 1; linear; genomic RNA; STD; VRL; 4966 BP.
XX
AC   EF012721;
XX
DT   20-APR-2007 (Rel. 91, Created)
DT   20-APR-2007 (Rel. 91, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate PV20 heat shock protein 70,
DE   heat shock protein 90, minor coat protein, and major coat protein genes,
DE   complete cds; and P19 gene, partial cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-4966
RX   PUBMED; 17223202.
RA   Beuve M., Sempe L., Lemaire O.;
RT   "A sensitive one-step real-time RT-PCR method for detecting Grapevine
RT   leafroll-associated virus 2 variants in grapevine";
RL   J. Virol. Methods 141(2):117-124(2007).
XX
RN   [2]
RP   1-4966
RA   Beuve M., Sempe L., Lemaire O.;
RT   ;
RL   Submitted (20-SEP-2006) to the EMBL/GenBank/DDBJ databases.
RL   Virology, INRA, 28 rue de Herrlisheim, Colmar 68021, France
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4966
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /specific_host="Vitis vinifera cv. Savagnin"
FT                   /isolate="PV20"
FT                   /mol_type="genomic RNA"
FT                   /country="France"
FT                   /isolation_source="leaves; wood"
FT                   /db_xref="taxon:64003"
FT   CDS             1. .1800
FT                   /codon_start=1
FT                   /product="heat shock protein 70"
FT                   /note="HSP70; ORF3"
FT                   /protein_id="ABK60003.1"
FT                   /translation="MVVFGLDFGTTFSTVCVYKDGRVYSFKQNNSAYIPTYLYLFSNSN
FT                   DMTFGYEAESLMHNSKVRGSFYRDLKRWVGCDGNNLDEYCERLKPHYSVRLVKIGAGLN
FT                   ETVSIGNYGGTVKSEVHLPGLIASFIKSMISCAESAFACPCTGVVCSVPANYDSVQRNF
FT                   TDQCVTLSGYRCVYMVNEPSAAALSTCNMINKKSASLAVYDFGGGTFDVSIISYRNNTF
FT                   VVRASGGDLNLGGRDVDRAFLEHLFSLTSLEPDLSLDISNLKESLSKTDAEIVYTLKGV
FT                   DDKKEDVRVSKNVLTKVMLPYVNRTLKILESTLKSYAKNMGEASNIKCDLVLIGGSSYL
FT                   PGLEDILTKHPSIDRVLKVPDPRAAVAVGCALYSSCLTGSQGLLLVDCAAHTISIADKY
FT                   CQQIICAPAGAPIPFSGTTPLYLARANKNSQRQIAVFEGEYVKCPKNRKICGANIKFFD
FT                   IGVTNVAYTPITFYLDVAISSVGAISFVVRGPEGKEVSLTGTPAYNFLSVDLGTRSVRE
FT                   LHISLSNKVHLGLLLHRLANRRLLFTKDEAVRYADTVEVTDVLKEYSSYTASSLPPDED
FT                   VEPLMGKSVQKVLRGGRLEEIPL"
FT   CDS             1727. .3334
FT                   /codon_start=1
FT                   /product="heat shock protein 90"
FT                   /note="HSP90; ORF4"
FT                   /protein_id="ABK60004.1"
FT                   /translation="MSNHSWESLFKKFYGEADWKKYLSRSIAAHASEVKNLPDTQLYGG
FT                   RIVRKADFESAQPRSFEQELGLFILSERDVQWSAMCGITVEEAAYELTNPRAYAYSGEK
FT                   CVPDVKTEGQKFSMEDVKSFMLRSNLDVGDKVLTEQCWSLSNSCGVLVNPDDKERFVAL
FT                   TFKNNADLISDQGTANVECRVGEYLVYAMSLFNYRSQRSQSGNVSLYEKYCEYIRTYLQ
FT                   NTDLFFNAPERIPLLTGILYDFCKEYNVFYSTYKRNVDNFRFFLTNYMPLISDIFVFQW
FT                   LKPAPDVRLLFEISAAELTLEVPTLNLIDSQVIIGHVLRYVESYTADPAIDAMEDKLEA
FT                   IMKSNNPRLSTAQLWVGFYCYYGEYRTAQQRVVRRPDTYKTPDSVGGFEINMKEVEEFF
FT                   SKLQRELPNVSLRRQFNGARAYEAFKIFKNGKISFKPISRLKIPKEFWYLNIDYFRHAN
FT                   RTGLSEEEILILNNISIDVRKLCAERATSTQPSAKRLSGNYKFGASSLRQGRKIENPLV
FT                   TLRNSLYEFQRRTHNGRG"
FT   CDS             3297. .3968
FT                   /codon_start=1
FT                   /product="minor coat protein"
FT                   /note="CPd; ORF5"
FT                   /protein_id="ABK60005.1"
FT                   /translation="MNSNAGLTTGGVETLETSGVVLTTRKDAVDKFFSELKNENYSSVD
FT                   SSRLSDLEVKEVLEKSKESFKSELASKDEHFVYHIIFFLIRCAIISTSEKVKYVGGHTY
FT                   VVEGKTYTVNDAWVFNMIKGLTKKYKRVNGLRAFCCACEDLYLTAAPTMSERFKTKSIG
FT                   NKGLPVGKEYLGADFLSGTSKLMSDYDRAITITAAKNAVDRSAFTGSERRIVSLYDIGK
FT                   I"
FT   CDS             4039. .4635
FT                   /codon_start=1
FT                   /product="major coat protein"
FT                   /note="CP; ORF6; 19 kDa"
FT                   /protein_id="ABK60006.1"
FT                   /translation="MELMSEENLSNLVITDASSLNGVDKKQLAAEVIKMLIEKGAPQEG
FT                   VEVVFGLLLYALAARTTSPKVQRSESDVILSNRFGERTVIVTEGDLKKVLENFPALAKY
FT                   TNKMRTFGRTFTEAYIDFCVAHGSKMPQLNAAVKLGIPADDSYLAADFLGACAKLSELQ
FT                   QSRKMFASMYALKTEGGGVNVPVSNLRQLGRREVL"
FT   CDS             4635. .>4966
FT                   /codon_start=1
FT                   /product="P19"
FT                   /note="19 kDa protein; ORF7"
FT                   /protein_id="ABK60007.1"
FT                   /translation="MELCVQSSESLVLLRTNQNTILLVVKSDDDVVLPKILICGYLRVS
FT                   HDGEVTGCDREDMIRDFRNNHYTILQSKFIHYDYESVTEEYVKSDCVVKFFLETGDVLW
FT                   FFLKGNG"
XX
SQ   Sequence 4966 BP; 1461 A; 943 C; 1166 G; 1396 T; 0 other;

ef012721 Length: 4966  20-APR-2007  Type: N  Check: 1952  ..

       1  atggtggttt ttggtttgga tttcggtacg actttttcga ccgtttgtgt
      51  gtataaagac ggtcgagtgt actccttcaa acaaaataat tccgcgtaca
     101  ttccgacgta tctctacctt ttctcaaatt ctaacgatat gactttcggg
     151  tatgaggctg aatcgctcat gcataactcg aaggtgaggg gctcttttta
     201  tagagatttg aaacgctggg tggggtgtga tggtaataac ctggatgagt
     251  actgcgagcg tttaaaaccg cactattcag ttcgattagt aaagatcggt
     301  gctggtttga atgaaaccgt ttcgataggt aactacgggg gcaccgtcaa
     351  atccgaggtg catttaccgg gtttgatagc gagttttatt aaatcgatga
     401  tcagttgtgc agagtcggct ttcgcctgtc cctgcactgg agtggtttgc
     451  tcagtgcccg cgaattacga tagtgttcag aggaatttca ccgaccaatg
     501  cgtgacattg agtggatatc gatgcgtata catggtcaac gaaccatccg
     551  ctgccgccct ttcgacctgt aatatgataa ataagaagtc tgcgagtcta
     601  gccgtatatg atttcggcgg tgggactttt gacgtttcta tcatctcgta
     651  ccgcaacaac acttttgttg tgcgtgcatc cggaggtgat ctgaatctcg
     701  gtgggaggga cgtggatcgc gcctttttgg aacacctttt ttctttaact
     751  tctttagaac cagatctttc gttagatatt tcgaatttaa aagaatcgct
     801  atctaaaact gatgctgaga ttgtttatac cctaaaaggt gttgatgata
     851  agaaggaaga tgtgagggtt agtaagaatg ttctcacgaa agtgatgctt
     901  ccttacgtga acagaacgtt gaaaatttta gaatccactc tcaaatcata
     951  cgcaaaaaat atgggagaag catcgaacat aaagtgtgat ttagtgttga
    1001  ttggcgggtc gtcttacctt ccgggtctgg aagatatttt aaccaagcat
    1051  ccgagcatcg atcgggttct gaaagttccg gaccctcgag cagcagtcgc
    1101  ggttggctgc gcattatact catcgtgtct aaccgggtcg caaggtttat
    1151  tattagttga ttgtgcggct cacacaatat ctattgccga caaatactgt
    1201  caacagatca tatgcgcgcc agctggagca ccaattcctt tctcgggtac
    1251  tacgccttta tacttggcta gagctaataa aaattcgcag cgtcaaatcg
    1301  ctgtgttcga aggcgagtac gttaaatgtc ccaaaaacag aaagatctgt
    1351  ggagctaata taaaattctt tgatataggg gtgacgaatg tcgcatacac
    1401  tcctatcacc ttctatttag atgtggctat ctctagtgtg ggagctatat
    1451  cttttgttgt taggggtccg gaggggaaag aggtgtcttt aacaggaacg
    1501  cccgcttaca atttcttatc cgtagatctc ggaacacgca gtgtccgaga
    1551  attacatatt agtttaagca ataaagttca tcttggtttg cttttacatc
    1601  gactagcaaa taggcgattg ttgttcacta aggacgaagc ggttcgttac
    1651  gcggacactg tagaagtgac tgacgtgtta aaagaatatt ccagctatac
    1701  cgcaagttcc ctacctccag acgaggatgt cgaaccactc atgggaaagt
    1751  ctgttcaaaa agttttacgg ggaggcagat tggaagaaat acctctctag
    1801  gagtattgcg gctcacgcgt ctgaagttaa aaaccttcct gatacgcagc
    1851  tgtacggcgg taggatcgta agaaaagcgg attttgaatc ggcacaaccg
    1901  agatcttttg aacaagaatt gggactcttc atattaagtg aacgggacgt
    1951  gcaatggagt gcgatgtgcg gcataacagt cgaagaggcc gcgtacgaac
    2001  tcaccaatcc cagagcttac gcctacagtg gagagaagtg tgttcctgat
    2051  gtcaaaacag aaggtcaaaa attttccatg gaagacgtta agagttttat
    2101  gctgcgatct aacttagacg tgggagacaa agttttaact gaacagtgtt
    2151  ggtctctttc caactcgtgt ggggtcttag tgaatcctga tgataaagag
    2201  cgatttgtgg cgcttacttt caagaacaat gctgatttaa tcagcgatca
    2251  aggtaccgcc aacgtggaat gtcgtgtagg tgaatatcta gtttacgcta
    2301  tgtcactttt taattacaga agtcagaggt cacaatctgg gaatgtttct
    2351  ttgtatgaaa agtattgtga gtatattaga acgtacttac aaaacacaga
    2401  tttgtttttt aatgcaccag aaaggatccc gttgcttaca ggcatcctgt
    2451  acgacttctg caaagagtat aatgtattct attccactta caaacgtaac
    2501  gttgataatt tcagattctt tctaacgaat tatatgcctc taatatcaga
    2551  catattcgta tttcagtggt taaagccagc tccggacgta cgactactat
    2601  tcgaaataag tgctgcggaa ttaacgttag aagtcccaac actcaattta
    2651  attgattcgc aagtgataat aggccatgtg ttaagatacg tcgaatcgta
    2701  tacggcagac ccggctattg atgctatgga ggataaactg gaggctataa
    2751  tgaaatctaa taacccacgg ttatccacag cgcaattgtg ggtaggtttt
    2801  tactgctatt atggtgaata tcgaacggct caacaacgag tcgtgcgaag
    2851  accagacacg tacaaaactc ccgattccgt aggtggtttt gaaataaaca
    2901  tgaaggaggt tgaagagttc tttagtaaat tgcagaggga gttacctaac
    2951  gtatctttgc gacgacaatt taacggtgct agagcgtacg aagcctttaa
    3001  gattttcaaa aatgggaaaa taagttttaa gcctatatcc cgcttaaaaa
    3051  taccgaaaga attttggtat ttaaatatag actacttcag gcacgcgaac
    3101  agaacgggtt tgagcgaaga agagatcctt atcttaaata acataagtat
    3151  cgatgttcga aaattgtgcg ctgagagagc aactagtacc cagcctagcg
    3201  ctaagcgcct tagtggaaat tataaatttg gtgcatcgtc attacgtcaa
    3251  gggcgtaaaa ttgaaaatcc gctggtaaca ctaagaaact ctctgtatga
    3301  attccaacgc aggactcaca acgggagggg ttgaaacgct tgaaacttca
    3351  ggggttgtgc tgaccacgcg caaagatgcg gtggataagt tcttcagtga
    3401  gttaaaaaat gagaactact cttcggtgga tagtagccga ttaagtgacc
    3451  tagaagtcaa agaagttctc gaaaaaagca aagaaagttt taagagcgaa
    3501  ctagcgtcta aagatgaaca ctttgtttac cacatcattt tcttcttaat
    3551  taggtgtgcc attatatcaa cgagtgaaaa agtcaagtac gttggtggcc
    3601  acacatacgt tgttgaagga aaaacttaca ccgtcaacga tgcttgggta
    3651  tttaacatga tcaaaggttt aacgaaaaaa tacaaaagag tcaacggttt
    3701  acgcgctttt tgttgcgctt gtgaagacct gtacctcacc gcagcaccca
    3751  cgatgtcaga gcgatttaaa accaagagca taggtaataa aggtctgcct
    3801  gtggggaagg aatatcttgg tgctgacttt ttatcaggaa caagtaaact
    3851  aatgagcgat tacgatagag ctatcaccat aacagcagca aagaacgcgg
    3901  ttgaccgaag cgcttttact ggaagtgaaa gaaggatagt tagcttatac
    3951  gacataggaa agatctaaac acgttgtgct ttagcgtgtg ccataatcat
    4001  aagttataat acttaaaggt gtggtgcaag gaatcacaat ggaattaatg
    4051  tccgaagaga acctgagcaa cctagtcatt accgacgcct caagcttgaa
    4101  tggtgtcgat aaaaagcagc tagctgccga agtaattaaa atgttaattg
    4151  agaagggtgc acctcaagaa ggtgttgaag tagtgtttgg tttactactt
    4201  tatgctctag ctgcgagaac tacttcccct aaagttcagc gatcggaatc
    4251  tgacgtgatt ctctccaata gattcggtga gagaactgtt atcgtcactg
    4301  agggcgattt gaaaaaagta ctcgagaact ttcccgctct cgctaaatat
    4351  actaataaaa tgcgaacatt cggccgcacc ttcactgaag cttacatcga
    4401  cttctgcgta gctcacggaa gtaagatgcc tcagctcaac gccgcagtca
    4451  aactaggaat accagcagat gattcttatc tagcggcaga tttcttgggt
    4501  gcttgtgcga agctctctga actgcagcaa agtagaaaga tgtttgctag
    4551  catgtatgct ctcaagactg aaggtggcgg cgtgaacgta ccagtgagta
    4601  atctgcgcca attgggtaga agagaagtgt tgtaatggag ctgtgtgttc
    4651  aatcctctga atcgttagtt ttactacgta cgaatcagaa cacgattcta
    4701  ctagtcgtta aatccgacga tgatgtggtg ttgcccaaaa ttttaatttg
    4751  cggttatttg cgtgtctctc atgatggaga ggttaccggt tgtgaccgcg
    4801  aagatatgat tagagacttt cgaaacaatc actacaccat actgcaatca
    4851  aaattcatac attacgatta cgaatctgta accgaagaat atgttaaatc
    4901  tgattgtgtg gtgaaattct ttttagaaac tggagacgtt ctttggtttt
    4951  tcttaaaagg caacgg