Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate ML12 coat protein gene, complete cds.

ACC No: EF028325

Dated: 2008-08-24 | Length: 672 | CRC: -406947609

                
ID   EF028325; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EF028325;
XX
DT   01-NOV-2006 (Rel. 89, Created)
DT   24-AUG-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate ML12 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18626763.
RA   Jiang B., Hong N., Wang G.P., Hu J., Zhang J.K., Wang C.X., Liu Y.,
RA   Fan X.D.;
RT   "Characterization of Citrus tristeza virus strains from southern China
RT   based on analysis of restriction patterns and sequences of their coat
RT   protein genes";
RL   Virus Genes 37(2):185-192(2008).
XX
RN   [2]
RP   1-672
RA   Zhang J.;
RT   ;
RL   Submitted (27-SEP-2006) to the EMBL/GenBank/DDBJ databases.
RL   Fruit Virology, National Indoor Conservation Center of Virus-Free Germplasm
RL   of Fruit Crops, Huazhong Agricultural University, Wuhan, HuBei 430070,
RL   China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="Citrus aurantifolia"
FT                   /isolate="ML12"
FT                   /mol_type="genomic RNA"
FT                   /country="China:JiangXi"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:A0FKQ9"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:A0FKQ9"
FT                   /protein_id="ABK20445.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDRDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 189 A; 125 C; 179 G; 179 T; 0 other;

ef028325 Length: 672  24-AUG-2008  Type: N  Check: 3800  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaagga
      51  aggcgacgat gttgttgcag cggagtcatc tttcggttcc ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaggtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  atatcctaat ttgtctgata gagataagga ctttcactta gctatgatgt
     251  tgtatcgttt ggcggttaag agttcatcat tgcaaagtga tgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaactt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc ggatttcttg accggagctg
     551  gcttgactga tttggaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagttgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga