Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate ML-13 coat protein gene, complete cds.

ACC No: EF028326

Dated: 2008-08-24 | Length: 672 | CRC: -2059745600

                
ID   EF028326; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EF028326;
XX
DT   01-NOV-2006 (Rel. 89, Created)
DT   24-AUG-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate ML-13 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18626763.
RA   Jiang B., Hong N., Wang G.P., Hu J., Zhang J.K., Wang C.X., Liu Y.,
RA   Fan X.D.;
RT   "Characterization of Citrus tristeza virus strains from southern China
RT   based on analysis of restriction patterns and sequences of their coat
RT   protein genes";
RL   Virus Genes 37(2):185-192(2008).
XX
RN   [2]
RP   1-672
RA   Zhang J.;
RT   ;
RL   Submitted (27-SEP-2006) to the EMBL/GenBank/DDBJ databases.
RL   Fruit Virology, National Indoor Conservation Center of Virus-Free Germplasm
RL   of Fruit Crops, Huazhong Agricultural University, Wuhan, HuBei 430070,
RL   China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="Citrus aurantifolia"
FT                   /isolate="ML-13"
FT                   /mol_type="genomic RNA"
FT                   /country="China:JiangXi"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:A0FKR0"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:A0FKR0"
FT                   /protein_id="ABK20446.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLGTQQNAALNRDLFLALKGKYPNLPDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 195 A; 123 C; 171 G; 183 T; 0 other;

ef028326 Length: 672  24-AUG-2008  Type: N  Check: 3619  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgctg ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttaggtact
     151  caacagaacg ctgctttgaa cagggactta ttccttgctc tgaaagggaa
     201  gtatcctaat ttgcctgaca aagataagga ctttcactta gctatgatgt
     251  tataccgttt agcggttaag agttcatcat tgcaaagtga tgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtagatt tgtctgacaa
     351  actttggacc gacatcgtgt ataattctaa gggtattggt aaccgaacta
     401  acgcccttcg agtctggggt agaactaacg atgctcttta cttagccttt
     451  tgtagacaga accgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggct gggtatcatt atttgtgtgc agatttcttg accggagctg
     551  gcttgactga tttggaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaaaaagc gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga