Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate s4 coat protein gene, complete cds.

ACC No: EF063109

Dated: 2008-08-24 | Length: 672 | CRC: 1667100148

                
ID   EF063109; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EF063109;
XX
DT   18-NOV-2006 (Rel. 89, Created)
DT   24-AUG-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate s4 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18626763.
RA   Jiang B., Hong N., Wang G.P., Hu J., Zhang J.K., Wang C.X., Liu Y.,
RA   Fan X.D.;
RT   "Characterization of Citrus tristeza virus strains from southern China
RT   based on analysis of restriction patterns and sequences of their coat
RT   protein genes";
RL   Virus Genes 37(2):185-192(2008).
XX
RN   [2]
RP   1-672
RA   Wang C.;
RT   "Citrus tristeza virus was extracted from Citrus sinensis in the field, and
RT   was grafted on Citrus aurantifolia";
RL   Unpublished.
XX
RN   [3]
RP   1-672
RA   Wang C.;
RT   ;
RL   Submitted (16-OCT-2006) to the EMBL/GenBank/DDBJ databases.
RL   Fruit Virology, National Indoor Conservation Center of Virus-Free Germplasm
RL   of Fruit Crops, Huazhong Agricultural University, Wuhan, Hubei 430070,
RL   China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="s4"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:A0SYP8"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:A0SYP8"
FT                   /protein_id="ABK58189.1"
FT                   /translation="MDDETKKLKNKNKETKEGDNVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLGTQQNAALNRDLFLTLKEKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDSTGIT
FT                   YTREGVEVDLSDKLWIDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 192 A; 121 C; 174 G; 185 T; 0 other;

ef063109 Length: 672  24-AUG-2008  Type: N  Check: 4608  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacaat gttgttgcag cggagtcttc tttcggttct gtaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ccgctttgaa cagagatttg tttcttactt tgaaagagaa
     201  gtatcctaat ttgtctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgacgactct
     301  acgggtataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggatt gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt aggactaacg atgcccttta tttagccttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagagtgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga