Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone C18A coat protein gene, complete cds.

ACC No: EF091430

Dated: 2006-12-08 | Length: 672 | CRC: 1216976174

                
ID   EF091430; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EF091430;
XX
DT   08-DEC-2006 (Rel. 90, Created)
DT   08-DEC-2006 (Rel. 90, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone C18A coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Harper S.J., Dawson T.E., Mooney P.A., Pearson M.N.;
RT   "Molecular characterization of Citrus tristeza virus isolates in New
RT   Zealand that overcome the resistance of Poncirus trifoliata (L.) Raf";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Harper S.J., Dawson T.E., Pearson M.N., Mooney P.A.;
RT   ;
RL   Submitted (27-OCT-2006) to the EMBL/GenBank/DDBJ databases.
RL   School of Biological Sciences, University of Auckland, 3A Symonds Street,
RL   Auckland 1010, New Zealand
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="NZ-18"
FT                   /serotype="MCA13+"
FT                   /mol_type="genomic RNA"
FT                   /country="New Zealand"
FT                   /clone="C18A"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="p25"
FT                   /protein_id="ABK80768.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMDDV
FT                   RRLGTQQNAALNRDLFLTLKEKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 187 A; 117 C; 182 G; 186 T; 0 other;

ef091430 Length: 672  08-DEC-2006  Type: N  Check: 7455  ..

       1  atggacgacg agacaaagaa attgaagaac aaaaacaagg aaacgaagga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttct gtaaacttac
     101  acatcgatcc gactctgata gcgatggacg atgtgcgtcg gttgggtacc
     151  caacagaatg ccgctttgaa tagagatttg tttcttactt tgaaagagaa
     201  gtatcctaat ttgtctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgacgacact
     301  acgggtataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc ggatttcttg accggagctg
     551  gcttgactga tttggaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagttgta gttaccaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga