Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone P18A minor coat protein gene, complete cds.

ACC No: EF091431

Dated: 2006-12-08 | Length: 723 | CRC: -1242843407

                
ID   EF091431; SV 1; linear; genomic RNA; STD; VRL; 723 BP.
XX
AC   EF091431;
XX
DT   08-DEC-2006 (Rel. 90, Created)
DT   08-DEC-2006 (Rel. 90, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone P18A minor coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-723
RA   Harper S.J., Dawson T.E., Mooney P.A., Pearson M.N.;
RT   "Molecular characterization of Citrus tristeza virus isolates in New
RT   Zealand that overcome the resistance of Poncirus trifoliata (L.) Raf";
RL   Unpublished.
XX
RN   [2]
RP   1-723
RA   Harper S.J., Dawson T.E., Mooney P.A., Pearson M.N.;
RT   ;
RL   Submitted (27-OCT-2006) to the EMBL/GenBank/DDBJ databases.
RL   School of Biological Sciences, University of Auckland, 3A Symonds Street,
RL   Auckland 1010, New Zealand
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .723
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="NZ-18"
FT                   /serotype="MCA13+"
FT                   /mol_type="genomic RNA"
FT                   /country="New Zealand"
FT                   /clone="P18A"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .723
FT                   /codon_start=1
FT                   /product="minor coat protein"
FT                   /note="p27"
FT                   /protein_id="ABK80769.1"
FT                   /translation="MAGYTMLPKTDDKEMDPVSAAVPGKYPDVIEKFVTNRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEQLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CTARLRPDLYENKRTTKAGTPHLKGYLSADFLTGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
XX
SQ   Sequence 723 BP; 222 A; 133 C; 166 G; 202 T; 0 other;

ef091431 Length: 723  08-DEC-2006  Type: N  Check: 8649  ..

       1  atggcgggtt acacgatgct tcccaaaact gatgacaaag aaatggaccc
      51  ggtgagtgcc gctgtgcccg gtaaataccc ggacgttatc gaaaagtttg
     101  tgaccaatag gtcggtagat gcgttaatag aaggtgttat tagcaagttg
     151  gatactaatt caatatacga agattccact gaaaaattta ctggtgagca
     201  attgaagtac gtcatggtta ctatggacac tttcttacta gaaaattaca
     251  aaacgaaaac ggaagatctg ctggttcact tggctatgat tcaaaagagg
     301  ttgtgcacta tatctacgag tactaaaacc aaatttcgtg ataaaggttg
     351  tatcagttac gtgcaagggg gtttacgata taagttaatg gataaagtag
     401  tttttccttt tattatatct aagtttactg acagggagac tccaaatgct
     451  ctacgtaagt atgcttgtac ttttgaggag ttacacttgt gcacggctag
     501  actgagaccc gacttatacg aaaacaaaag gacgaccaaa gctgggactc
     551  cgcatttaaa agggtactta tcagctgact ttcttacggg ttccctccca
     601  ggatactccg aacatgaacg aggtatcatc cttcgagcgt ctgagtctat
     651  gttagctaga cgtcaaggtt acgaggaagc aaccgaactt cttaacttac
     701  gcgatttggg aaagtatttg tag