Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 clone WC3-73 24 kDa protein gene, complete cds.

ACC No: EF103906

Dated: 2007-04-21 | Length: 878 | CRC: -1619879243

                
ID   EF103906; SV 1; linear; genomic RNA; STD; VRL; 878 BP.
XX
AC   EF103906;
XX
DT   27-DEC-2006 (Rel. 90, Created)
DT   21-APR-2007 (Rel. 91, Last updated, Version 2)
XX
DE   Grapevine leafroll-associated virus 2 clone WC3-73 24 kDa protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-878
RX   PUBMED; 17129630.
RA   Prosser S.W., Goszczynski D.E., Meng B.;
RT   "Molecular analysis of double-stranded RNAs reveals complex infection of
RT   grapevines with multiple viruses";
RL   Virus Res. 124(1-2):151-159(2007).
XX
RN   [2]
RP   1-878
RA   Meng B.;
RT   ;
RL   Submitted (04-NOV-2006) to the EMBL/GenBank/DDBJ databases.
RL   Molecular and Cellular Biology, University of Guelph, 50 Stone Road East,
RL   Guelph, Ontario N1G 2W1, Canada
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .878
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /specific_host="Vitis vinifera cv. Waltham Cross"
FT                   /strain="PN"
FT                   /mol_type="genomic RNA"
FT                   /country="South Africa"
FT                   /clone="WC3-73"
FT                   /db_xref="taxon:64003"
FT   CDS             74. .691
FT                   /codon_start=1
FT                   /product="24 kDa protein"
FT                   /note="p24; ORF8"
FT                   /db_xref="UniProtKB/TrEMBL:A1YLX3"
FT                   /protein_id="ABM05869.1"
FT                   /translation="MRVIVSPYEAEDILKRSTDMLRNIDSGVLSTKECIKAFSTITRDL
FT                   HCAKASYQWGVDTGLYQRNCAEKRLIDTVESNIRLAQPLVREKVAVHFCKDEPKELIAF
FT                   ITRKYVELTGVGVREAVKREMRSLTKTVLNKMSLEMAFYMSPRAWKNAEWLELKFSPVK
FT                   IFRDLLLDVETPNELCAEDDVHVDKVNENGDENHDLELQDEC"
XX
SQ   Sequence 878 BP; 287 A; 144 C; 207 G; 240 T; 0 other;

ef103906 Length: 878  21-APR-2007  Type: N  Check: 1430  ..

       1  cattgtttga agcaggtact aactgaaact gaatctataa tcgattcttt
      51  ttgcgaagaa agaaatcgtt aagatgaggg ttatagtgtc tccttatgaa
     101  gctgaagaca ttctgaaaag atcgactgac atgttacgaa acatagacag
     151  tggggtcttg agcactaaag aatgtatcaa ggcattctcg acgataacgc
     201  gagacctaca ttgtgcgaag gcttcctacc agtggggtgt tgacactggg
     251  ttatatcagc gtaattgcgc tgaaaaacgt ttaattgaca cggtggagtc
     301  aaacatacgg ttggctcaac ctctcgtgcg tgaaaaagtg gcggttcatt
     351  tttgtaagga tgaaccaaaa gagctaatag cattcatcac gcgaaagtac
     401  gtggaactca cgggcgtggg agtgagagaa gcggtgaaga gggaaatgcg
     451  ctctcttacc aaaacagttt taaataaaat gtctttggaa atggcgtttt
     501  acatgtcacc acgagcgtgg aaaaacgctg aatggttaga actaaaattt
     551  tcacctgtga aaatctttag agatctgcta ttagacgtgg aaacgcccaa
     601  cgaattgtgc gccgaagatg atgttcacgt cgacaaagta aatgagaatg
     651  gggacgaaaa tcacgacctc gaactccaag acgaatgtta aacattggtt
     701  aagtttaacg aaaataatta gtaaataata aatcgaacgt gggtgtatct
     751  acctgacgta tcaacttaag ctgttactga gtaattaaac caacaagtgt
     801  tggtgtaatg tgtatgttga tgtagagaaa aatccgtttg ttgaacggtg
     851  tttttctctt ctttattttt aaaaaaat