Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 clone WC3-36 24 kDa protein gene, complete cds.

ACC No: EF103907

Dated: 2007-04-21 | Length: 900 | CRC: -641961746

                
ID   EF103907; SV 1; linear; genomic RNA; STD; VRL; 900 BP.
XX
AC   EF103907;
XX
DT   27-DEC-2006 (Rel. 90, Created)
DT   21-APR-2007 (Rel. 91, Last updated, Version 2)
XX
DE   Grapevine leafroll-associated virus 2 clone WC3-36 24 kDa protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-900
RX   PUBMED; 17129630.
RA   Prosser S.W., Goszczynski D.E., Meng B.;
RT   "Molecular analysis of double-stranded RNAs reveals complex infection of
RT   grapevines with multiple viruses";
RL   Virus Res. 124(1-2):151-159(2007).
XX
RN   [2]
RP   1-900
RA   Meng B.;
RT   ;
RL   Submitted (04-NOV-2006) to the EMBL/GenBank/DDBJ databases.
RL   Molecular and Cellular Biology, University of Guelph, 50 Stone Road East,
RL   Guelph, Ontario N1G 2W1, Canada
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .900
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /specific_host="Vitis vinifera cv. Waltham Cross"
FT                   /strain="WC"
FT                   /mol_type="genomic RNA"
FT                   /country="South Africa"
FT                   /clone="WC3-36"
FT                   /db_xref="taxon:64003"
FT   CDS             75. .692
FT                   /codon_start=1
FT                   /product="24 kDa protein"
FT                   /note="p24; ORF8"
FT                   /db_xref="UniProtKB/TrEMBL:A1YLX4"
FT                   /protein_id="ABM05870.1"
FT                   /translation="MRVIVSPYEAEDILKRSTDMLRNINSGVLNTKECIKVFSTITRDL
FT                   HCAKASYQWGVDTGLYQRDCAEKRLIDTVESNIRLAQPLVREKVAAHFCKDEPKELVAF
FT                   ITRKYVELTGVGVRKVVKKEMRSLTKTVLNKLSLEMAFYMSPRAWKNAEWLDLKFSPVK
FT                   IFRDLLLDVETLNDLCAEDDVHVEKMNENEDENHDLELQDEC"
XX
SQ   Sequence 900 BP; 296 A; 155 C; 212 G; 237 T; 0 other;

ef103907 Length: 900  21-APR-2007  Type: N  Check: 5460  ..

       1  cgattgtttg aagcaggtac taactgaaac tgagtctata atcgattctt
      51  tttgtgagga aagaaatcgt taagatgagg gttatagtat ctccttacga
     101  agccgaagac attctgaaaa gatctactga tatgttacga aacataaaca
     151  gtggggtact gaatacgaaa gagtgcatca aggtgttctc gacaataact
     201  cgagacctac actgtgcaaa ggcttcttac cagtggggtg tagacactgg
     251  gttgtaccag cgcgactgcg ctgagaaacg cttaatcgac acggtggagt
     301  caaacatacg gttggctcaa cctctcgtgc gcgagaaggt ggcggctcac
     351  ttttgtaaag acgagccaaa agaattggta gcattcatca cgcgaaagta
     401  tgtggaacta acgggtgtgg gagtaagaaa ggtagtgaag aaagaaatgc
     451  gctctctaac caagacggtt ttaaataaac tatcattgga aatggcgttt
     501  tacatgtcac ctcgagcgtg gaaaaacgct gagtggttag atctaaagtt
     551  ttcaccagtg aaaatcttta gagacctact gttagacgtg gagacgctca
     601  acgacttgtg cgccgaagac gatgttcacg tcgaaaaaat gaatgaaaac
     651  gaggacgaga atcatgatct cgaactccaa gacgaatgtt aaaactctat
     701  taagtctaaa aatcttaata cgagcatgaa taaataatta gtaaacaata
     751  aatcgaacgt gggtgtatct acctgacgta tcaacttaag ctgttactgg
     801  gtaattaagc caacaagtgt tggtgtaatg tgtatgttga tgtagagaaa
     851  aatccgtttc taaagcggcg tttttctctt cttttatttt taaaaaaaat