Sequence of DPV Raspberry leaf mottle virus
Raspberry mottle virus major coat protein gene, complete cds.
ACC No: EF114209
Dated: 2007-06-13 | Length: 597 | CRC: 2143847032
ID EF114209; SV 1; linear; genomic RNA; STD; VRL; 597 BP. XX AC EF114209; XX DT 07-MAR-2007 (Rel. 90, Created) DT 13-JUN-2007 (Rel. 92, Last updated, Version 3) XX DE Raspberry mottle virus major coat protein gene, complete cds. XX KW . XX OS Raspberry mottle virus OC Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae; OC Closterovirus. XX RN [1] RP 1-597 RX PUBMED; 17448559. RA Tzanetakis I.E., Halgren A., Mosier N., Martin R.R.; RT "Identification and characterization of Raspberry mottle virus, a novel RT member of the Closteroviridae"; RL Virus Res. 127(1):26-33(2007). XX RN [2] RP 1-597 RA Tzanetakis I.E., Halgren A.B., Mosier N., Martin R.R.; RT ; RL Submitted (10-NOV-2006) to the EMBL/GenBank/DDBJ databases. RL Botany and Plant Pathology & HCRL, Oregon State University and USDA-ARS, RL 3420 Orchard Ave, Corvallis, OR 97331, USA XX FH Key Location/Qualifiers FH FT source 1. .597 FT /organism="Raspberry mottle virus" FT /isolate="leaf tissue from raspberry leaf mottle at SCRI FT (Scottish Crop Research Institute)" FT /mol_type="genomic RNA" FT /country="United Kingdom:Scotland" FT /db_xref="taxon:326941" FT CDS 1. .597 FT /codon_start=1 FT /product="major coat protein" FT /note="p22; CP" FT /db_xref="GOA:A3R4A5" FT /db_xref="UniProtKB/TrEMBL:A3R4A5" FT /protein_id="ABO15358.1" FT /translation="MAEFTIADLKEINVADNTTLSEEVEAKITKPLLAKIETANPGFDD FT KGAKLLVGMILYRLALRTTSPNATFNAHDVTTYKVDGKSVKFDDEMVFGYVANHEAIPP FT GIKNPLRAWGRALDQKYLKFIRPLKTTLDFNQRCNKIGLPVGYEYLCADFLTGAGLDNQ FT EAAILNLGRAEALKKEVGDTGHSITSIKQLGRFST" XX SQ Sequence 597 BP; 163 A; 137 C; 149 G; 148 T; 0 other; ef114209 Length: 597 13-JUN-2007 Type: N Check: 1637 .. 1 atggcggaat tcacgatcgc agacttgaaa gaaattaatg tggcagataa 51 caccactctt tcggaggagg tggaggcaaa gattaccaaa ccgctcctcg 101 ctaaaatcga gaccgccaat cccggttttg atgacaaagg cgccaagttg 151 ttagtaggga tgatacttta caggttggct ttgcgtacta cttcgcccaa 201 cgccactttt aacgcacatg acgtcaccac ctacaaagta gatggtaaga 251 gcgtgaaatt cgatgatgaa atggtgttcg gttacgttgc taatcacgag 301 gctatcccac ccggtatcaa gaaccctctc agggcttggg gtcgcgcatt 351 agatcagaaa tatctaaaat tcattcggcc gttgaagacc actttggact 401 tcaatcagcg ttgcaataag atagggcttc ctgtaggtta tgagtacctg 451 tgtgccgatt ttcttaccgg ggctggtttg gacaaccaag aggctgccat 501 attgaaccta ggtagagcag aggctctcaa gaaggaggtt ggcgacaccg 551 gtcattcgat cacctcgata aagcagttag gtcgcttttc cacctaa