Sequence of DPV Penaeus vannamei nodavirus

Penaeus vannamei nodavirus segment RNA2 capsid protein gene, complete cds.

ACC No: EF137180

Dated: 2010-09-17 | Length: 1183 | CRC: -1380184904

                
ID   EF137180; SV 2; linear; genomic RNA; STD; VRL; 1183 BP.
XX
AC   EF137180;
XX
DT   10-MAY-2007 (Rel. 91, Created)
DT   17-SEP-2010 (Rel. 106, Last updated, Version 4)
XX
DE   Penaeus vannamei nodavirus segment RNA2 capsid protein gene, complete cds.
XX
KW   .
XX
OS   Penaeus vannamei nodavirus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Nodaviridae;
OC   unclassified Nodaviridae.
XX
RN   [1]
RP   1-1183
RX   PUBMED; 17629112.
RA   Tang K.F., Pantoja C.R., Redman R.M., Lightner D.V.;
RT   "Development of in situ hybridization and RT-PCR assay for the detection of
RT   a nodavirus (PvNV) that causes muscle necrosis in Penaeus vannamei";
RL   Dis. Aquat. Org. 75(3):183-190(2007).
XX
RN   [2]
RP   1-1183
RA   Tang K.F.J., Lightner D.V.;
RT   ;
RL   Submitted (22-NOV-2006) to the EMBL/GenBank/DDBJ databases.
RL   Veterinary Science and Microbiology, University of Arizona, 1117 E. Lowell,
RL   Tucson, AZ 86721, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-1183
RA   Tang K.F.J., Lightner D.V.;
RT   ;
RL   Submitted (14-SEP-2010) to the EMBL/GenBank/DDBJ databases.
RL   Veterinary Science and Microbiology, University of Arizona, 1117 E. Lowell,
RL   Tucson, AZ 86721, USA
XX
CC   On Sep 14, 2010 this sequence version replaced gi:132424403.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1183
FT                   /organism="Penaeus vannamei nodavirus"
FT                   /segment="RNA2"
FT                   /host="Penaeus vannamei"
FT                   /mol_type="genomic RNA"
FT                   /country="Belize"
FT                   /collection_date="2005"
FT                   /db_xref="taxon:430911"
FT   CDS             60. .1166
FT                   /codon_start=1
FT                   /product="capsid protein"
FT                   /db_xref="GOA:A5H7Q8"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:A5H7Q8"
FT                   /protein_id="ABO33432.2"
FT                   /translation="MKRKPNSNQNNNNNRGNGNGLRRVRGGRVSRRRVVINQSNQSMPV
FT                   TSNGAPLQALTSYSRPNVNKISRLGPDSDFLTSVVAKASTSIVTPADRILVKQPLSASS
FT                   FPGTRITGLSSYWERYKWLSAVARYVPAVPNTVACQFVMYIDTDPLDDPSNISDDNQIV
FT                   RQAVSQAGSNQFNFNTSKTVPLIVRADNQYYYTGVDKQNLRFSLQGILYIIQVTDLINF
FT                   NGELITQDLTCGSLFLDWLVNFSIPQINPTSLTDVRVDKAVNFIKPEVSGVAEIQTVTG
FT                   LSPSTSYLLTPAFLEQNFQSEAGIYILSATPVEGEGTISINMDPTVTTVSGFIKVKTDT
FT                   FGTFDLSVVLTTASKKQTTGFNIIAATS"
XX
SQ   Sequence 1183 BP; 305 A; 268 C; 241 G; 369 T; 0 other;

ef137180 Length: 1183  17-SEP-2010  Type: N  Check: 7409  ..

       1  ccgcgctgag cgttaagcga cgtgatcgcg tgcggcgcaa cggatcggcg
      51  agtttactaa tgaaacgtaa accaaattct aatcagaata acaacaacaa
     101  tcgtgggaac ggcaatggac tccgccgggt gcgtggcgga agggtatctc
     151  gccgaagggt ggttatcaat caatccaatc aaagtatgcc cgtcacgagt
     201  aatggcgctc ctttgcaagc tctcacttcc tattctcgtc ccaacgttaa
     251  taaaatatct cgattgggac ctgactccga ctttctgact tctgtggtgg
     301  ccaaagcttc tactagtatc gttactccag cagaccgtat acttgttaag
     351  caaccgctat cagcctcctc cttccctggt actagaatta ctggtttgtc
     401  tagttattgg gaacgctata agtggttatc agctgtagcc cgttacgtcc
     451  cagcggtgcc aaatacagtt gcctgtcagt ttgtcatgta tattgatact
     501  gatcctctcg acgatccttc taatatatct gacgataatc aaattgtgag
     551  acaggctgtc tcacaggctg gttcaaatca gtttaatttc aatacttcca
     601  aaactgtgcc tttgatcgtt cgagcagata atcagtatta ttatactgga
     651  gtggataaac aaaatttacg tttcagtctg cagggtatcc tttatatcat
     701  tcaggttaca gatctcatta atttcaatgg tgaattgatt actcaagatc
     751  tgacctgtgg ttccctgttc ttggactggc ttgtgaattt ctctattcct
     801  caaattaatc caaccagtct tacagacgtt cgtgtggata aggcagttaa
     851  cttcattaaa cctgaagtta gtggtgttgc tgaaattcaa acggttactg
     901  gtctttcacc tagtaccagt taccttctaa cacctgcttt tctagagcag
     951  aatttccagt cagaggctgg tatttacatc ttgtctgcca caccagttga
    1001  gggcgaaggt actatttcaa tcaatatgga tcctacagtt acgactgttt
    1051  caggtttcat taaggttaag accgatacct tcggtacctt cgacctctct
    1101  gtcgtcttaa ctactgctag taagaaacaa accacaggtt tcaatattat
    1151  agcagctact tcttagtttg tgtgtttatc ttt