Sequence of DPV Eggplant mottled crinkle virus

Eggplant mottled crinkle virus strain G coat protein gene, complete cds.

ACC No: EF140907

Dated: 2008-04-15 | Length: 1225 | CRC: 1058687604

                
ID   EF140907; SV 1; linear; genomic RNA; STD; VRL; 1225 BP.
XX
AC   EF140907;
XX
DT   26-JAN-2007 (Rel. 90, Created)
DT   15-APR-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Eggplant mottled crinkle virus strain G coat protein gene, complete cds.
XX
KW   .
XX
OS   Eggplant mottled crinkle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1225
RA   Rasoulpour R., Izadpanah K.;
RT   "First report of Eggplant Mottled Crinkle Virus in Geranium in Iran";
RL   (er) New Dis. Rep. 14, 04 (2007)
XX
RN   [2]
RP   1-1225
RA   Rasoulpour R., Izadpanah K.;
RT   "First report of Eggplant Mottled Crinkle Virus in Geranium in Iran";
RL   Plant Pathol. 57:397-397(2008).
XX
RN   [3]
RP   1-1225
RA   Rasoulpour R., Izadpanah K.;
RT   ;
RL   Submitted (28-NOV-2006) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, Plant Virology Research Center, Shiraz, Fars 98 71444,
RL   Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1225
FT                   /organism="Eggplant mottled crinkle virus"
FT                   /specific_host="geranium (Pelargonium hortorum)"
FT                   /strain="G"
FT                   /mol_type="genomic RNA"
FT                   /country="Iran"
FT                   /collected_by="R. Rasoulpour"
FT                   /collection_date="Sep-2006"
FT                   /identified_by="R. Rasoulpour and K. Izadpanah"
FT                   /virion
FT                   /db_xref="taxon:270256"
FT   CDS             23. .1189
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:A2TC19"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:A2TC19"
FT                   /protein_id="ABK92203.1"
FT                   /translation="MDIVRRNNNNAIAINKKQLASMEATAAAGALSNYVKNNEAMIVQG
FT                   AVNMGKKAYGVARNRKNKGNSQAMVHVSGMGGAMMAPVAVSRQLVARKPKFAGTTAGSV
FT                   TGTHREYLTHENNSPAFTTNGGIVGNLLQLSPLNGTLFSWLPAIASNFDRYVFNSVVLH
FT                   YVPLCGTNELGRVAMYWHKDSEDPEPVDRVELPNFGILKETAPWAEAILRVSTDKTNRY
FT                   CDDSTVVDRKLIDLGQLGISTYGGAGTNPVGDVFVSYSVTLYFPQPTNTVFSTRQLSLT
FT                   GALEACIGPGYINVAHTPTLLAITFRSTGTFLLSGVFRDNSVAVLGVPGGIGINSQTSL
FT                   DVVGVPTSFHVNCTVSTLPATLTYGCVGITSVTENCTRATRTNSPTFL"
XX
SQ   Sequence 1225 BP; 335 A; 273 C; 312 G; 305 T; 0 other;

ef140907 Length: 1225  15-APR-2008  Type: N  Check: 6328  ..

       1  agtgaacaca agcgacatag aaatggacat cgttaggaga aacaataata
      51  atgcaatcgc aatcaacaag aaacaactgg cctctatgga ggctactgcc
     101  gccgctgggg ctcttagcaa ttatgtgaag aacaatgaag caatgattgt
     151  acaaggtgcg gtgaatatgg gcaagaaagc ttatggagta gcaaggaacc
     201  gtaagaataa gggtaattcg caggcgatgg tgcacgtaag tggtatgggc
     251  ggggctatga tggcccctgt ggcagtatct cggcaacttg tggccagaaa
     301  gccaaagttc gcaggtacga ctgctggatc agtcacaggc acccaccgtg
     351  agtacttaac ccacgagaac aactcccctg cttttacaac caatggaggg
     401  attgtcggga atttgttaca actcagcccg cttaatggca cactgttttc
     451  gtggttaccg gctatcgcgt cgaacttcga tcggtacgtc tttaacagcg
     501  ttgtgttaca ttatgtcccc ctctgtggca caaatgaatt agggcgtgtt
     551  gcaatgtact ggcataagga ctctgaggat cctgagcctg tggatagagt
     601  ggaattacct aatttcggta tacttaaaga gacggcacca tgggccgaag
     651  ctattttgag ggtctcaact gataagacga atcgatactg cgatgacagt
     701  acagtggttg acaggaagct tatcgaccta ggacagctcg gaatatctac
     751  atatggagga gccggaacta atcctgtggg ggatgtgttt gtgtcgtata
     801  gcgttacgct ttacttccca caacccacga ataccgtatt cagtacgcga
     851  cagcttagcc ttactggcgc cttagaagca tgtattgggc ctggatatat
     901  taacgtagca catacaccaa cactcttggc tataacattc aggtccacgg
     951  gaactttcct gctttcagga gttttccggg acaatagtgt tgctgttctt
    1001  ggtgtgccgg ggggcatagg aattaatagt caaacctcac tagatgttgt
    1051  tggcgtaccc acatcatttc atgtgaactg tacagtgtcc acactacccg
    1101  ccacactcac atatggatgt gtagggataa catctgttac tgagaattgc
    1151  acacgggcca ccaggaccaa ttccccaaca tttctatagt tgcatagggg
    1201  tctcttgaac agaccagttc atgga