Sequence of DPV Beet black scorch virus

Beet black scorch virus isolate CO, complete genome.

ACC No: EF153268

Dated: 2010-09-16 | Length: 3642 | CRC: -1449120691

                
ID   EF153268; SV 1; linear; genomic RNA; STD; VRL; 3642 BP.
XX
AC   EF153268;
XX
DT   11-MAR-2007 (Rel. 91, Created)
DT   16-SEP-2010 (Rel. 106, Last updated, Version 2)
XX
DE   Beet black scorch virus isolate CO, complete genome.
XX
KW   .
XX
OS   Beet black scorch virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Necrovirus.
XX
RN   [1]
RP   1-3642
RX   PUBMED; 18943682.
RA   Weiland J.J., Van Winkle D., Edwards M.C., Larson R.L., Shelver W.L.,
RA   Freeman T.P., Liu H.Y.;
RT   "Characterization of a U.S. Isolate of Beet black scorch virus";
RL   Phytopathology 97(10):1245-1254(2007).
XX
RN   [2]
RP   1-3642
RA   Weiland J., Van Winkle D., Edwards M., Larson R., Shelver W., Freeman T.,
RA   Liu H.-Y.;
RT   ;
RL   Submitted (30-NOV-2006) to the EMBL/GenBank/DDBJ databases.
RL   Sugarbeet Research, USDA-ARS, Northern Crop Science Laboratory, 1307 18th
RL   St. N, Fargo, ND 58105, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3642
FT                   /organism="Beet black scorch virus"
FT                   /isolate="CO"
FT                   /mol_type="genomic RNA"
FT                   /country="USA:Colorado"
FT                   /db_xref="taxon:196375"
FT   CDS             34. .2208
FT                   /codon_start=1
FT                   /transl_except=(pos:643. .645,aa:OTHER)
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="p82; ORF2; produced by suppression of translation
FT                   stop codon terminating ORF1"
FT                   /db_xref="GOA:A3R4U6"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR013707"
FT                   /db_xref="UniProtKB/TrEMBL:A3R4U6"
FT                   /protein_id="ABO18577.1"
FT                   /translation="MDSIPYVILRILDFVFRSIFFPSLLFIINHNTTILWACACAYGFY
FT                   RAFRLIFKIKVEVHPATRAVFNDMVTRFQQESMFSPNDEVPEGIPIHEDVDLVSDPTHK
FT                   DIKRVRASRRVSYAVRVAHVAKSKVGLLANTKANELVYSRLCRDEMVIHGVRPSHIAHA
FT                   VPLAVAACFIPLDSDFLAASIRNCEGMEERRAVLGPSYGKXGGLLCTSGFTTPTWRGNP
FT                   EGLLVKRGPPLAKPRKLYRFSGFGTHIRYGVHDHSLGNVRRGLVERLFMVETKDGLAPT
FT                   PKPTPGVYAKLSRFHDLVSANLTSTTRLTYEQFLGFYSGRKLERYQQAVESLAIRPIGV
FT                   QDAWLSTFVKAEKLNISAKPDPAPRVIQPRSPRYNVEVGRFLRHAEEHLFDAIDRVYGG
FT                   RTVFKGLNADQAGMEMQAMWQEFDNPVGIGMDASRFDQHVSKEALEFEHKIWLSMYHGA
FT                   DRKILSKLLGMQIHNRGLARCPDGEIRYTVEGCRMSGDINTSSGNCYIMCASVHNYCSR
FT                   LGVMRFRLANNGDDCMLVVEAKDEARVRQGLIEYYRELGFTMKVEPTVYELEHLEFCQT
FT                   RPVLVNGAYRMVRNLHQGMSKDLHSLHDLGSRKAAEAWVSAVGSGGRVMNDGVPVLKSF
FT                   FMQFPLSSGPKTKSDMSIALQEDWKYKFNRTGCFKNLTPTPQSRYSFWRAFGVLPDEQI
FT                   ALENGFSRLSFDKLDQDVQEEVSLLQFSGA"
FT   CDS             34. .645
FT                   /codon_start=1
FT                   /product="p23"
FT                   /note="ORF1"
FT                   /db_xref="GOA:A3R4U7"
FT                   /db_xref="InterPro:IPR013707"
FT                   /db_xref="UniProtKB/TrEMBL:A3R4U7"
FT                   /protein_id="ABO18576.1"
FT                   /translation="MDSIPYVILRILDFVFRSIFFPSLLFIINHNTTILWACACAYGFY
FT                   RAFRLIFKIKVEVHPATRAVFNDMVTRFQQESMFSPNDEVPEGIPIHEDVDLVSDPTHK
FT                   DIKRVRASRRVSYAVRVAHVAKSKVGLLANTKANELVYSRLCRDEMVIHGVRPSHIAHA
FT                   VPLAVAACFIPLDSDFLAASIRNCEGMEERRAVLGPSYGK"
FT   CDS             2126. .2242
FT                   /codon_start=1
FT                   /product="p4"
FT                   /note="ORF3"
FT                   /db_xref="UniProtKB/TrEMBL:A3R4U8"
FT                   /protein_id="ABO18578.1"
FT                   /translation="MDFLVLALTSWTRMSRRRLASSSSLGHENLTTFHGTTA"
FT   CDS             2226. .2417
FT                   /codon_start=1
FT                   /product="p7a"
FT                   /note="ORF4"
FT                   /db_xref="UniProtKB/TrEMBL:A3R4U9"
FT                   /protein_id="ABO18579.1"
FT                   /translation="MEQQRSEQRRERRVRSKSEDRKSMSDVGQSAVNREADIKKDMGPS
FT                   VSMTVVGENVEFTQHFHF"
FT   CDS             2419. .2616
FT                   /codon_start=1
FT                   /product="p7b"
FT                   /note="ORF5"
FT                   /db_xref="UniProtKB/TrEMBL:A3R4V0"
FT                   /protein_id="ABO18580.1"
FT                   /translation="MSTIYVVQEESSGFLVWALVVAIVCIIGLLSYTPPERLNHSYHEN
FT                   NQKTQYITIGGASTSKVSTN"
FT   CDS             2432. .2575
FT                   /codon_start=1
FT                   /product="p5b"
FT                   /note="ORF6"
FT                   /db_xref="UniProtKB/TrEMBL:A3R4V1"
FT                   /protein_id="ABO18581.1"
FT                   /translation="MLCRRSPLGSSCGHWLLQLCASLDSYHTPHLKDLTTLITKTIRRR
FT                   NT"
FT   CDS             2645. .3343
FT                   /codon_start=1
FT                   /product="p25"
FT                   /note="capsid protein; ORF7"
FT                   /db_xref="GOA:A3R4V2"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:A3R4V2"
FT                   /protein_id="ABO18582.1"
FT                   /translation="MAPKRNKGSKKTRMSDETVRAPAAGGVIQRTPGIPPRIRSTTIGT
FT                   RVTNTELLAGINVAAAGAFSVVGAGLFPSNLGWLNGIASNYSKFRWLAIKLIYVPIVPT
FT                   TTAGAMTMALSYDPADATPTSFQQVQQMYNSITAPVWAGFDGATVQLLGERPTTGAVCI
FT                   DVDVNRFGFTWYRYATLAAITALTANDRNLYIPSVCNVATSGGSAATNVGNLMIKYSIE
FT                   LIEPIPAAIN"
FT   CDS             2691. .2975
FT                   /codon_start=1
FT                   /product="p10"
FT                   /note="ORF8"
FT                   /db_xref="UniProtKB/TrEMBL:A3R4V3"
FT                   /protein_id="ABO18583.1"
FT                   /translation="MRQCGLLLLVASYNVHLAFLLVLGPPLLVRVSPTLSCSQELMLLP
FT                   QGPSQSLVLVCSPATLAGLMGLLLTIANLDGLLSSSSMFPSSLLRLLGQ"
XX
SQ   Sequence 3642 BP; 888 A; 850 C; 952 G; 952 T; 0 other;

ef153268 Length: 3642  16-SEP-2010  Type: N  Check: 3488  ..

       1  gaaacctaac cagtttctcg ttgatcagcg atcatggatt caatcccgta
      51  tgtgatcctg cgcatactcg attttgtctt ccgctccatc ttctttccat
     101  ccctactctt catcatcaat cacaacacca ctatcctatg ggcatgtgct
     151  tgtgcctatg ggttttaccg tgcatttcgc cttatcttca agataaaggt
     201  ggaggtacac ccagccaccc gagccgtctt caacgacatg gtcacccgtt
     251  tccagcagga gagtatgttc tcacctaatg acgaagtgcc ggagggtatc
     301  ccgatacacg aggatgttga ccttgttagc gaccccacac acaaagatat
     351  taagcgggtc cgtgctagca ggcgagtctc atatgccgtg agggttgccc
     401  atgtagccaa gtcgaaggtg ggactactcg ccaataccaa ggcgaatgag
     451  ctggtttact cccgcctatg cagagatgag atggttatcc acggtgtacg
     501  cccatcgcac attgcacacg cagtgccgct agctgtcgcg gcctgcttca
     551  taccactaga cagtgatttc ctcgcagcct ctatcaggaa ttgcgagggg
     601  atggaggagc ggagggccgt gttggggccc tcatatggaa aatagggagg
     651  cctactctgc accagcgggt ttaccacgcc aacttggcgt ggtaatccag
     701  agggtttgct ggtgaagaga ggaccacctc tggctaaacc taggaaactg
     751  taccgttttt ctgggtttgg gactcatata cggtacggag tgcacgacca
     801  ctcattgggc aatgttcgga ggggacttgt tgagcggcta ttcatggtgg
     851  aaaccaagga tggcttagct ccaacaccaa agcccacccc tggcgtgtac
     901  gccaagttat cccggtttca cgacctagtt agtgccaatc taacctcgac
     951  caccagatta acatacgagc aatttctcgg attttattct ggtcgcaaat
    1001  tggagaggta ccaacaggct gtggagtcgt tagcaatccg cccaataggg
    1051  gtacaggatg cttggcttag cacgtttgtt aaggctgaaa aattaaacat
    1101  ctcagctaaa cccgatccgg cacctagggt cattcagcct aggtcgccga
    1151  ggtataatgt ggaggttgga cggttcctca gacatgctga ggaacatttg
    1201  ttcgacgcca ttgaccgtgt gtatggtggg cggacggtgt tcaaggggtt
    1251  gaatgccgat caggctggca tggagatgca agccatgtgg caagagttcg
    1301  acaatcctgt aggcatcggt atggatgcgt ctcgtttcga ccaacacgtc
    1351  tctaaggagg cgttggagtt cgaacacaag atttggctgt ccatgtatca
    1401  tggggctgac aggaaaatct tatcgaagct gttggggatg caaatccaca
    1451  accgcggtct tgctagatgc cctgatgggg aaatcaggta cacggtagag
    1501  gggtgtcgta tgtctggaga tattaacaca tcttccggaa actgctatat
    1551  tatgtgtgct tcagtgcaca actattgcag ccggttgggt gttatgagat
    1601  ttagacttgc caacaatggt gatgattgca tgcttgtggt cgaagccaag
    1651  gatgaggcac gtgtgaggca ggggctcatc gagtattaca gggagttagg
    1701  tttcacaatg aaagtggagc ccactgtcta tgaactcgag cacttggagt
    1751  tttgccaaac gcgcccagtc cttgttaatg gggcttatcg tatggtgcgc
    1801  aatcttcatc aaggtatgtc taaggatcta cactccttgc atgatcttgg
    1851  tagtaggaaa gctgctgaag cttgggtttc agcagttggc agcggaggcc
    1901  gcgtaatgaa tgatggggta ccagtgctca aatcattctt tatgcagttt
    1951  cctctgtcct ctggtcctaa aaccaagtcc gatatgagta tagcgttgca
    2001  ggaagattgg aaatacaaat tcaatcggac tgggtgtttc aagaatttga
    2051  cacccactcc acaatcccgc tactcatttt ggcgtgcgtt cggagtgttg
    2101  ccagatgaac agattgctct agagaatgga ttttctcgtc ttagctttga
    2151  caagctggac caggatgtcc aggaggaggt tagcctcctc cagttctctg
    2201  gggcatgaaa acctaaccac ttttcatgga acaacagcgt agcgaacaac
    2251  gtcgtgagcg tagagtgaga agcaaatcgg aggacaggaa gtctatgtct
    2301  gatgttgggc aatctgctgt caacagggaa gcagatatca agaaagacat
    2351  gggtccatcg gtttctatga cggtggtggg ggagaatgtg gagtttacac
    2401  aacatttcca cttctgaaat gagcaccatt tatgttgtgc aggaggagtc
    2451  ctctgggttc ctcgtgtggg cattggttgt tgcaattgtg tgcatcattg
    2501  gactcttatc atacacccca cctgaaagac ttaaccactc ttatcacgaa
    2551  aacaatcaga agacgcaata cataactatt ggaggagcat ccactagtaa
    2601  agtttccacg aactgaattt actgctttct agtatagtta ataaatggca
    2651  cctaaacgta ataaaggaag caagaagacc cgcatgtccg atgagacagt
    2701  gcgggctcct gctgctggtg gcgtcataca acgtacacct ggcattcctc
    2751  ctcgtattag gtccaccact attggtacgc gtgtcaccaa cactgagctg
    2801  ctcgcaggaa ttaatgttgc tgccgcaggg gccttctcag tcgttggtgc
    2851  tggtctgttc cccagcaacc ttggctggct taatgggatt gcttctaact
    2901  atagcaaatt tagatggctt gctatcaagc tcatctatgt tcccatcgtc
    2951  cctactacga ctgctggggc aatgaccatg gctttatctt atgatcccgc
    3001  tgatgctaca ccaactagtt ttcaacaggt gcaacagatg tataacagca
    3051  tcacagcgcc tgtctgggct ggttttgatg gagctactgt tcagcttctt
    3101  ggggagcgtc cgacaactgg ggctgtgtgc attgacgtgg atgtgaatcg
    3151  gtttggattc acatggtaca gatatgccac gcttgctgcc attaccgcac
    3201  tcactgcaaa tgataggaat ctttacattc ccagtgtttg caatgtggct
    3251  acttctggcg gctccgcagc taccaatgtt ggtaatttga tgataaagta
    3301  tagtattgag ctcattgagc caatacccgc tgccatcaat tagatcccac
    3351  atcctggtgt ggttaatcca gtgaaaaata ttaggaaatc cttgggattc
    3401  acgccccgag ggggattgct tgcatagtgc aggtatgttg agtcacactg
    3451  tgaggtattg gtgctgaatc ctggtaaaca ggcttgacag gtttgggtgg
    3501  ttccaaaccg atgtattacc caagatactc atggtactcc actagaaaac
    3551  actatgcgtg cgcacacggc tggctatgtc ctatcatagc tgggggcccc
    3601  ggagtgcgaa accctcttat atacctggtc ttccaggtgc cc