Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate T3 P33 gene, partial cds; P6 gene, complete cds; and P65 gene, partial cds.

ACC No: EF200107

Dated: 2007-01-15 | Length: 1030 | CRC: 773468582

                
ID   EF200107; SV 1; linear; genomic RNA; STD; VRL; 1030 BP.
XX
AC   EF200107;
XX
DT   15-JAN-2007 (Rel. 90, Created)
DT   15-JAN-2007 (Rel. 90, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate T3 P33 gene, partial cds; P6 gene, complete
DE   cds; and P65 gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-1030
RA   Hilf M.E.;
RT   "Discovery of New Viral Genotypes of Citrus Tristeza Virus with
RT   Overlapping, Degenerate Primers";
RL   Unpublished.
XX
RN   [2]
RP   1-1030
RA   Hilf M.E.;
RT   ;
RL   Submitted (27-DEC-2006) to the EMBL/GenBank/DDBJ databases.
RL   USDA-ARS-USHRL, 2001 S. Rock Road, Fort Pierce, FL 34945, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1030
FT                   /organism="Citrus tristeza virus"
FT                   /lab_host="sweet orange"
FT                   /isolate="T3"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /virion
FT                   /db_xref="taxon:12162"
FT   CDS             <1. .27
FT                   /codon_start=1
FT                   /product="P33"
FT                   /protein_id="ABM60771.1"
FT                   /translation="GLLAVIFI"
FT   CDS             97. .252
FT                   /codon_start=1
FT                   /product="P6"
FT                   /protein_id="ABM60772.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNTSPY
FT                   GTHATV"
FT   CDS             258. .>1030
FT                   /codon_start=1
FT                   /product="P65"
FT                   /note="hsp70 homolog"
FT                   /protein_id="ABM60773.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGEPGSFYKDLKRWVGCTEKNYQSYLHKLSPSYEVVVKEFGTKSMP
FT                   VPYLSPLNNNLGLSVALPSLIASYAKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSVSLSGYSCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDRKLSDKIYELADFLPQKEL"
XX
SQ   Sequence 1030 BP; 244 A; 204 C; 246 G; 336 T; 0 other;

ef200107 Length: 1030  15-JAN-2007  Type: N  Check: 9360  ..

       1  ggtttgttag ccgttatatt catatgattt ggtgtagcaa cttatgaggt
      51  gtaattagct aaaactcgcc gtttgactct gtttaaacgg ggttcaatgg
     101  actgtgtgat tcaaggattt ttgacttttc tggttggcat agctgtattt
     151  tcggcttttg ccggattgat tatcattgtt ataacgatct atcggtgtac
     201  gactaaacct gttagaaaca cctctcctta cggcactcac gccactgtct
     251  aagcggtatg gtgcttctgg gtttagattt tggtaccacg ttttcgacgg
     301  tggctatggc tacatcttct gagttagtta tacttaaaca atccaattcg
     351  tcgtacatac ctacgtgttt gtttctgcac gcggacccca acagcgtatc
     401  ttatggttac gacgcggagt atttagcggc ttcgggggaa cctggctcat
     451  tttacaaaga tttgaaacgg tgggtcggtt gcactgagaa gaactaccag
     501  agctacctgc acaagttgtc accttcctat gaggtggtag tgaaagaatt
     551  tggaactaag agtatgccgg ttccgtattt gtcacctttg aataacaatc
     601  tcgggctcag cgtcgctttg ccttcattga tcgcttcata tgccaaatcc
     651  attttatcgg atgcagaaag agtgttcaat gtgagttgca ctggagttat
     701  atgttcggta cctgctggtt ataacacgtt acagcgagct tttacgcaac
     751  aaagtgtgtc cttgtcgggt tactcttgcg tgtatattat taatgaacct
     801  tccgccgccg cttactccac tttacctaag ttgagttcgg cggataagta
     851  cttggccgtt tacgactttg gtggtgggac ttttgatgtt tctatagtta
     901  gtgttaggtt acccacgttc gccgttagaa gttcaggtgg tgatatgaac
     951  ttaggcggca gagacatcga tagaaaatta tctgataaaa tatatgagtt
    1001  ggccgacttt ctaccgcaaa aggaactgaa