Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate NS25 CP gene, partial cds; P18 gene, complete cds; and P13 gene, partial cds.

ACC No: EF200110

Dated: 2007-01-15 | Length: 840 | CRC: -1751353101

                
ID   EF200110; SV 1; linear; genomic RNA; STD; VRL; 840 BP.
XX
AC   EF200110;
XX
DT   15-JAN-2007 (Rel. 90, Created)
DT   15-JAN-2007 (Rel. 90, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate NS25 CP gene, partial cds; P18 gene, complete
DE   cds; and P13 gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-840
RA   Hilf M.E.;
RT   "Discovery of New Viral Genotypes of Citrus Tristeza Virus with
RT   Overlapping, Degenerate Primers";
RL   Unpublished.
XX
RN   [2]
RP   1-840
RA   Hilf M.E.;
RT   ;
RL   Submitted (27-DEC-2006) to the EMBL/GenBank/DDBJ databases.
RL   USDA-ARS-USHRL, 2001 S. Rock Road, Fort Pierce, FL 34945, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .840
FT                   /organism="Citrus tristeza virus"
FT                   /lab_host="sweet orange"
FT                   /isolate="NS25"
FT                   /mol_type="genomic RNA"
FT                   /country="New Zealand"
FT                   /virion
FT                   /db_xref="taxon:12162"
FT   CDS             <1. .84
FT                   /codon_start=1
FT                   /product="CP"
FT                   /note="major capsid protein"
FT                   /protein_id="ABM60780.1"
FT                   /translation="KEQLLKKRGADEVVVTNVRQLGKFNTR"
FT   CDS             50. .553
FT                   /codon_start=1
FT                   /product="P18"
FT                   /protein_id="ABM60781.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRFVSGWWSFIVNVGDIIVRFALHVPSE
FT                   DVLNSFSAISNCTIIADGSALLKDNTVVDRLESMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLICLAITSDRVLFKVIMGTNVDDSRCGCSIWFYNNGMFQNGLTRCNNLVAL
FT                   FSAT"
FT   CDS             587. .>840
FT                   /codon_start=1
FT                   /product="P13"
FT                   /protein_id="ABM60782.1"
FT                   /translation="MSIRRVWLKVMAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYELANFDLDFLRIVVIPLSGGAVNESRADRA"
XX
SQ   Sequence 840 BP; 218 A; 140 C; 200 G; 282 T; 0 other;

ef200110 Length: 840  15-JAN-2007  Type: N  Check: 9747  ..

       1  aaagaacaat tgttgaagaa gcgaggggct gatgaagtcg tagttactaa
      51  tgtcaggcag cttgggaaat ttaacacacg ttgatctatt gcgttctgat
     101  tcccggtttg tatcgggatg gtggagtttc atcgtgaacg tgggtgatat
     151  aatcgttcgg tttgcgttac acgttcctag tgaagatgtg ctgaacagct
     201  tttcagctat atcgaattgt acgatcatag cggacggtag tgctttacta
     251  aaagacaaca ccgtggttga ccgtttagag agcatgaacc ctttggctta
     301  tttgttaaaa ttagcgaaaa cgactactac tatttgtttt actatgtcta
     351  ataaggttct ttttggtact actaaatccg aaccgcttat ttgtttagct
     401  attacatcgg accgagtttt attcaaagtt attatgggta ctaacgttga
     451  tgattctcga tgtggctgca gtatttggtt ttacaacaat gggatgtttc
     501  aaaatgggtt gacccgttgt aataatctcg tcgctttgtt tagcgcgact
     551  tagacacgaa gtgaccgttc gggtttaatt gctgcaatga gtattcgacg
     601  tgtgtggtta aaggtaatgg ctgtaattac ggtattgtgg tatggtaaag
     651  aaccttccat tagcgaaggt tacaacgctc ttatgaatga tgactttaag
     701  tttatcgata cgcatttttc aaacgtctct tatgctaaga aatgttacga
     751  attggctaat ttcgatttag actttctacg catcgttgtc attcccctaa
     801  gtggtggtgc ggtgaatgaa tcgcgtgcag atcgcgctaa