Sequence of DPV Nootka lupine vein clearing virus

Nootka lupine vein-clearing virus, complete genome.

ACC No: EF207438

Dated: 2007-11-01 | Length: 4172 | CRC: -192698085

                
ID   EF207438; SV 1; linear; genomic RNA; STD; VRL; 4172 BP.
XX
AC   EF207438;
XX
DT   31-JAN-2007 (Rel. 90, Created)
DT   01-NOV-2007 (Rel. 93, Last updated, Version 2)
XX
DE   Nootka lupine vein-clearing virus, complete genome.
XX
KW   .
XX
OS   Nootka lupine vein-clearing virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae.
XX
RN   [1]
RP   1-4172
RX   PUBMED; 17657600.
RA   Robertson N.L., Cote F., Pare C., Leblanc E., Bergeron M.G., Leclerc D.;
RT   "Complete nucleotide sequence of Nootka lupine vein-clearing virus";
RL   Virus Genes 35(3):807-814(2007).
XX
RN   [2]
RP   1-4172
RA   Cote F., Robertson N.L., Pare C., Leblanc E., Bergeron M.G., Leclerc D.;
RT   ;
RL   Submitted (05-JAN-2007) to the EMBL/GenBank/DDBJ databases.
RL   Infectious Disease Research Center, University Laval, 2705 Boul. Laurier,
RL   Quebec, Quebec G1V-4G2, Canada
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4172
FT                   /organism="Nootka lupine vein-clearing virus"
FT                   /specific_host="Lupinus nootkatensis Donn"
FT                   /isolate="Alaska"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collected_by="Nancy L. Robertson"
FT                   /identified_by="Nancy L. Robertson"
FT                   /virion
FT                   /db_xref="taxon:283876"
FT   CDS             60. .809
FT                   /codon_start=1
FT                   /product="N-terminus replicase"
FT                   /db_xref="UniProtKB/TrEMBL:A2TJS8"
FT                   /protein_id="ABM92359.1"
FT                   /translation="MGVFSKLAKELVIGSGTLGVLGCCLYAAAVVRVTVGTVEFGIAAV
FT                   NTVSDFVQSGGLSIPTVPQYPNLGYSPFQVELDQSAGKEDEGISMLEASTLEEKKEADS
FT                   EGKMVVVSRKRKVNRHQKGQFVMDVVRKAKMHFGCTPSPTRANELAVAKYVAGLCKEQH
FT                   LVASHAREVTEVAKALVFTPDIAEIQGTKLLNSYRAYARRVALHDAQQIDQWWLNLVKH
FT                   PLSTNSWAEAWYTLNGAPPRAAVQFNK"
FT   CDS             <810. .2387
FT                   /codon_start=1
FT                   /product="replicase/polymerase"
FT                   /note="read through product"
FT                   /db_xref="GOA:A2TJS9"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:A2TJS9"
FT                   /protein_id="ABM92360.1"
FT                   /translation="GGLFHLDGVCTKIRRGSHPSVVEVEKTNAPKLRRLYKLNTMHSGY
FT                   QFSIHNNSYQNLRRGLIERVYYVENKQKGELQACPRPEQGVFKEMAYLRRRFVNVCGQH
FT                   TRISTEQFVDLYQGRKRTIYQQAAESLSERPLDRKDAELRTFVKAEKFNQSKKPDPAPR
FT                   VIQPRNPRYNVKLGLYLKKFEKHACRALDRIWGGPTVMKGYTVEEVGQHIRGAWCQYSR
FT                   PVAIGFDMERFDQHVSVPALQFEHSLYMGCFSNDPELRELLDMQLHSFGIGLSSNGYCR
FT                   YKTEGGRKSGDMNTGLGNCALACLITKHVLRGVPCRLINNGDDCVVVCDELDAARVMAL
FT                   VAPGWARFGFKCIVEKPVRNFEEIVFCQMQPMFDGETWLMVRTVDVALSKDCHSTVRWD
FT                   SVKQAKKWLRAVGMCGIRLTGGVPIMQEFYQKMVDSTESCELKNMEGLLEGTGFYILAK
FT                   NSKRGYRAISDEARFSFYLMTGIVPDVQTALEHEIAAGKINMEIDLSAGPPEFLAEIIT
FT                   SLVNGNRT"
FT   CDS             2371. .2574
FT                   /codon_start=1
FT                   /product="MP1"
FT                   /note="movement protein 1"
FT                   /db_xref="GOA:A2TJT0"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:A2TJT0"
FT                   /protein_id="ABM92361.1"
FT                   /translation="MEIEHKEIKLGGKKKPRQAVGSKGRGTGKRLVAHAAVDKDAPKGN
FT                   SGGSYVFVADTMEVRNKIVFNF"
FT   CDS             2471. .2692
FT                   /codon_start=1
FT                   /product="MP2"
FT                   /note="movement protein 2"
FT                   /db_xref="UniProtKB/TrEMBL:A2TJT1"
FT                   /protein_id="ABM92362.1"
FT                   /translation="MRLWIKMHLRVIVGVVTFLLLTRWKFAIRSFSISEILPPLITLNQ
FT                   IITLSFLILFVNCLCRGGDTIFLDPLHR"
FT   CDS             2729. .3766
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="nucleocapsid"
FT                   /db_xref="GOA:A2TJT2"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:A2TJT2"
FT                   /protein_id="ABM92363.1"
FT                   /translation="MTNSSAITNHPATTKAAVSGVAWAVKLRSKGWASLTTAQKRAARL
FT                   ATGISDGPVVVVMPKRNKVKNPNNHTIEGQAGKSTNISKAEFISTVTGSTGSSPTFSSW
FT                   RINPSDVGSFPTISCFANRFNQYQITSMAVRFSPARSFQTNGMISLAFTDDSTDPVPTS
FT                   RQQMAGYTSMVSSEVSQNLLMKIRGDSKRRYIRDSTNENGKLVDFGRVILSVHGCDSGV
FT                   GDLGDLYFEYTIRFSDPTFVQRDSQTSAEEEEVGPHFADFRATDTEWTATLVAPGNWVV
FT                   SVVGSNVPDRMTIRGDGATGEVHEGGDSYSYVAVAVVRAQIQGAVVALNLTGGGKVTKV
FT                   VVSRM"
XX
SQ   Sequence 4172 BP; 1082 A; 905 C; 1143 G; 1042 T; 0 other;

ef207438 Length: 4172  01-NOV-2007  Type: N  Check: 4900  ..

       1  tttctggcag gactcccgag tgttagattt cgttcttcca ctattttgcg
      51  ttggctaaaa tgggtgtatt ttccaaattg gctaaagagt tagtgattgg
     101  ttccggtacc ctaggtgtcc ttggctgttg tctgtatgct gcagctgtag
     151  tcagagtaac cgtgggtacc gttgagttcg gaattgccgc agttaacact
     201  gtcagcgatt tcgtacaaag tgggggtctc tcaataccca ctgtcccaca
     251  atatccaaac ttggggtaca gcccctttca ggttgaactg gaccaatccg
     301  ctgggaaaga ggatgaaggc atttctatgt tggaggcctc aaccctagag
     351  gaaaagaagg aggctgatag cgaaggtaag atggttgtag tgagtcgcaa
     401  gaggaaagtt aacaggcacc aaaaggggca attcgtcatg gacgtggtgc
     451  ggaaggctaa aatgcacttc gggtgcactc cctcacccac cagggccaac
     501  gaactagcgg ttgccaagta tgtggccggt ctatgtaagg aacaacatct
     551  ggtggcgtct cacgccaggg aggttacgga ggtggccaag gcattagtgt
     601  ttactcccga catcgctgaa atacagggca cgaaactgct gaattcttac
     651  cgtgcgtacg cacgtcgtgt tgccctccat gacgcccaac aaattgacca
     701  atggtggtta aatctagtga aacatccact ttccacgaac agttgggcgg
     751  aagcatggta cactctgaac ggcgccccac cccgggcagc ggttcagttt
     801  aataaatagg ggggtctttt ccatctcgac ggtgtgtgta cgaagattcg
     851  tagggggtcg cacccgtctg tggttgaggt ggagaaaacc aacgccccta
     901  aacttaggag actctacaaa ctaaacacga tgcatagtgg gtaccagttc
     951  agtatccaca acaattcgta ccaaaacctc aggagaggtc tcatcgaaag
    1001  agtctactac gtggaaaaca aacaaaaagg tgagttacaa gcttgtccgc
    1051  gccctgagca gggtgttttc aaagagatgg cgtatctgcg tcgcaggttt
    1101  gtgaatgtgt gtggtcaaca tacccggatc tccacggagc aatttgtgga
    1151  tttgtatcag ggcaggaaac gcaccattta tcaacaggcc gcagaaagtc
    1201  tatcagagag accactcgat cgcaaggacg ctgagttacg gacgtttgtc
    1251  aaggcggaaa aatttaatca gtctaagaaa ccagacccgg ctcctagggt
    1301  tatccagccg aggaacccca gatacaacgt gaagttgggc ttgtacttga
    1351  agaaattcga gaaacatgct tgtcgagctc tcgaccgtat ttggggtggg
    1401  cctactgtta tgaaaggata taccgtggag gaagtgggac aacatattcg
    1451  gggcgcttgg tgccagtatt ccaggcccgt ggcgattggt tttgatatgg
    1501  agagattcga ccaacacgtg tctgtcccag cgcttcaatt cgaacattcc
    1551  ctatacatgg gctgtttttc aaatgacccg gagctgcgtg agttgcttga
    1601  tatgcagctc cacagtttcg ggattggtct gagttccaat ggttactgta
    1651  ggtacaaaac tgaagggggt aggaaatcgg gggatatgaa caccggtctc
    1701  ggtaattgtg cactggcatg tttgattacg aaacacgtac tcagaggtgt
    1751  gccttgcagg ttgatcaaca acggtgacga ctgtgtagtc gtgtgtgatg
    1801  aactggatgc cgcccgtgtt atggccttgg ttgctccagg ctgggctaga
    1851  ttcggcttca aatgcattgt tgagaaacct gttcggaact tcgaggaaat
    1901  tgtgttttgt cagatgcagc ctatgttcga tggcgaaacc tggttgatgg
    1951  tccgtacggt ggatgtggcc ctatctaaag attgtcacag tacagtgcgt
    2001  tgggattcgg tcaaacaggc gaaaaagtgg ttgcgtgcag tggggatgtg
    2051  tggaatcaga ttaactgggg gcgtaccgat tatgcaagaa ttttatcaga
    2101  aaatggttga ttcgactgaa agttgtgagc tgaagaacat ggagggttta
    2151  ttggagggga cggggtttta cattctggcc aagaacagca agcggggcta
    2201  tagagcaatt agtgatgagg ctcggttttc gttttatctg atgaccggta
    2251  tcgtgcccga tgtgcaaacc gcattggaac atgagattgc tgctgggaag
    2301  attaatatgg aaattgacct gtctgctggc ccccctgaat tcttggcgga
    2351  aatcatcacc tctctagtaa atggaaatcg aacataagga aatcaaattg
    2401  ggtgggaaaa agaaaccgcg gcaagcagtt ggatcaaagg ggaggggaac
    2451  tgggaaaagg ctagtagccc atgcggctgt ggataaagat gcacctaagg
    2501  gtaatagtgg gggtagttac gtttttgttg ctgacacgat ggaagttcgc
    2551  aataagatcg ttttcaattt ctgaaatttt gcccccgctg attactctta
    2601  atcaaatcat aactctcagt ttcctcatac tctttgtgaa ctgtctttgt
    2651  cgcggcggcg atacaatctt tttagatcca ttacacagat aactccaaac
    2701  ttcaacacat aaaaattgac actaaagaat gacaaactcc agtgcgataa
    2751  caaatcatcc agcaacaacc aaggctgccg tttctggggt agcttgggct
    2801  gttaagctgc gatccaaggg ttgggcttcc ttgaccacgg ctcaaaagag
    2851  ggcagcgcga ctggcgaccg gaatttctga cggtcccgtt gtagttgtta
    2901  tgcccaagcg gaacaaggtc aagaacccca acaatcacac tattgaagga
    2951  caagctggga aatccacgaa catatccaaa gctgaattca tctccactgt
    3001  caccggatct acgggctctt ctcccacctt tagctcatgg cggatcaatc
    3051  cgtctgacgt aggtagtttt cccaccatta gttgttttgc taaccggttc
    3101  aatcaatacc agattaccag tatggcagtg cggttttccc cggctaggag
    3151  tttccaaacc aatgggatga tctcactcgc tttcactgat gacagcaccg
    3201  atccggtccc cactagcagg cagcagatgg caggttacac cagcatggtg
    3251  agttctgagg tgagtcaaaa cctgttgatg aaaatccgtg gtgatagtaa
    3301  gaggagatac ataagggatt ccaccaatga gaacggcaaa ttggtggatt
    3351  ttggtagggt catactgtct gtacacgggt gtgatagcgg ggtgggggat
    3401  cttggggacc tctactttga atacaccata cgttttagtg atcctacctt
    3451  tgttcaacgg gattcccaaa ctagtgctga agaggaagaa gtcgggcctc
    3501  attttgccga ttttcgtgcc actgacactg aatggactgc cactttagtc
    3551  gcacccggga attgggttgt gagtgtggtt gggagcaatg ttcctgaccg
    3601  catgacgatc cggggtgacg gcgcgactgg ggaggtacac gaaggtggtg
    3651  actcttacag ttacgttgcg gtcgcagtcg tgcgagcgca gatacaaggg
    3701  gccgtggtgg ccctcaacct tactggaggc ggaaaagtta ctaaggttgt
    3751  tgtgtcacgc atgtgattca acgcctcggt ccgaattccg aaattccaca
    3801  cacactgttg agattcattg tgtgggttga ctaacgtgca tgagtgagat
    3851  agcagactcc ctgactattc ctagggcacc catcctcttc ttgatgggat
    3901  aagctaggta aggggacaga acactgcaga agctttaatt tggccgccac
    3951  caaacatgca tggaataaaa tgtgtcaacc ctgattgatc tacacagtgt
    4001  gtcgggaacg tacgattcgc gcttaccaga gggaaacacc acaagtccag
    4051  gggggtctgg acgataataa ccattgaagc agtaaagatc cgaaaggtga
    4101  gggctctgtt ctagatggta accctgtttt taaattagtc ggagaaactt
    4151  ccacagagtt tttccggcgc cc