Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CY95-14-46 coat protein gene, partial cds.

ACC No: EF491667

Dated: 2007-05-23 | Length: 669 | CRC: -2105735945

                
ID   EF491667; SV 1; linear; genomic RNA; STD; VRL; 669 BP.
XX
AC   EF491667;
XX
DT   23-MAY-2007 (Rel. 91, Created)
DT   23-MAY-2007 (Rel. 91, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CY95-14-46 coat protein gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-669
RA   Papayiannis L., Kyriakou A., Santos C., Nolasco G.;
RT   "Molecular characterization of Citrus tristeza virus (CTV) isolates from
RT   Cyprus on the basis of the coat protein gene";
RL   J. Plant Pathol. 89(2):281-285(2007).
XX
RN   [2]
RP   1-669
RA   Papayiannis L., Kyriakou A., Santos C., Nolasco G.;
RT   ;
RL   Submitted (13-MAR-2007) to the EMBL/GenBank/DDBJ databases.
RL   FERN, Univ. Algarve, Faro 8005-139, Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .669
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="CY95-14-46"
FT                   /mol_type="genomic RNA"
FT                   /country="Cyprus"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .>669
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ABQ42894.1"
FT                   /translation="MDDETKTLKNKNKETREGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNTALNRDLFLTLKGKYPNLPDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 669 BP; 196 A; 128 C; 164 G; 181 T; 0 other;

ef491667 Length: 669  23-MAY-2007  Type: N  Check: 2106  ..

       1  atggacgacg aaacaaagac attgaagaac aaaaacaagg aaacgagaga
      51  aggcgacgat gttgttgccg ctgagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc aactctgata gcgatgaatg acgtgcgtca gttgggtacc
     151  caacagaaca ctgctttaaa cagagactta tttcttactt tgaaagggaa
     201  gtatcctaac ttacctgaca aagataagga ctttcactta gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga tgacgatact
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggc aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaaa atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagttgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgt