Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CY98-33-61 coat protein gene, partial cds.

ACC No: EF491671

Dated: 2007-05-23 | Length: 669 | CRC: -601004668

                
ID   EF491671; SV 1; linear; genomic RNA; STD; VRL; 669 BP.
XX
AC   EF491671;
XX
DT   23-MAY-2007 (Rel. 91, Created)
DT   23-MAY-2007 (Rel. 91, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CY98-33-61 coat protein gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-669
RA   Papayiannis L., Kyriakou A., Santos C., Nolasco G.;
RT   "Molecular characterization of Citrus tristeza virus (CTV) isolates from
RT   Cyprus on the basis of the coat protein gene";
RL   J. Plant Pathol. 89(2):281-285(2007).
XX
RN   [2]
RP   1-669
RA   Papayiannis L., Santos C., Kyriakou A., Nolasco G.;
RT   ;
RL   Submitted (13-MAR-2007) to the EMBL/GenBank/DDBJ databases.
RL   FERN, Univ. Algarve, Faro 8005-139, Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .669
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="CY98-33-61"
FT                   /mol_type="genomic RNA"
FT                   /country="Cyprus"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .>669
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ABQ42898.1"
FT                   /translation="MDDETKTLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYLQAKELLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 669 BP; 194 A; 124 C; 170 G; 181 T; 0 other;

ef491671 Length: 669  23-MAY-2007  Type: N  Check: 4470  ..

       1  atggacgacg aaacaaagac attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag ctgagtcttc tttcggttcg ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcccaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtgtga cgtacactcg ggaaggtgtt gaagtggagt tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc ggatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtact tacaagctaa agagctatta
     601  ttaaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgt