Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CY89-60-36 coat protein gene, partial cds.

ACC No: EF491673

Dated: 2007-05-23 | Length: 669 | CRC: 1049432250

                
ID   EF491673; SV 1; linear; genomic RNA; STD; VRL; 669 BP.
XX
AC   EF491673;
XX
DT   23-MAY-2007 (Rel. 91, Created)
DT   23-MAY-2007 (Rel. 91, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CY89-60-36 coat protein gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-669
RA   Papayiannis L., Kyriakou A., Santos C., Nolasco G.;
RT   "Molecular characterization of Citrus tristeza virus (CTV) isolates from
RT   Cyprus on the basis of the coat protein gene";
RL   J. Plant Pathol. 89(2):281-285(2007).
XX
RN   [2]
RP   1-669
RA   Papayiannis L., Santos C., Kyriakou A., Nolasco G.;
RT   ;
RL   Submitted (13-MAR-2007) to the EMBL/GenBank/DDBJ databases.
RL   FERN, Univ. Algarve, Faro 8005-139, Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .669
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="CY89-60-36"
FT                   /mol_type="genomic RNA"
FT                   /country="Cyprus"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .>669
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ABQ42900.1"
FT                   /translation="MDDETKKLKNKNKETKEGVDVVAAESSFGSMNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHLAMMLYRLAVKSSSLQSDDDATGIT
FT                   YTREGVEVDLSDKLWTDVVFNSNGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 669 BP; 188 A; 124 C; 175 G; 182 T; 0 other;

ef491673 Length: 669  23-MAY-2007  Type: N  Check: 4338  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcgtcgat gttgttgcag cagagtcttc tttcggttcc atgaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggaacc
     151  caacagaacg ccgctttgaa cagagatttg tttcttactc tgaaagggaa
     201  gtatcctaac ttgcctgaca aggataagga cttccactta gctatgatgt
     251  tatatcgttt agcggttaag agttcatcgt tgcaaagtga tgatgacgcc
     301  acgggcataa catatactcg ggagggtgtt gaagtggatt tgtctgacaa
     351  gctttggact gacgtcgtgt ttaactctaa cggtattggt aaccgtacta
     401  atgcccttcg agtctggggt aggactaacg atgcccttta tttagctttc
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  gattccggct ggatatcatt acctatgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa ggaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgt