Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CY93-10 coat protein gene, partial cds.

ACC No: EF491676

Dated: 2007-05-23 | Length: 669 | CRC: 480888916

                
ID   EF491676; SV 1; linear; genomic RNA; STD; VRL; 669 BP.
XX
AC   EF491676;
XX
DT   23-MAY-2007 (Rel. 91, Created)
DT   23-MAY-2007 (Rel. 91, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CY93-10 coat protein gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-669
RA   Papayiannis L., Kyriakou A., Santos C., Nolasco G.;
RT   "Molecular characterization of Citrus tristeza virus (CTV) isolates from
RT   Cyprus on the basis of the coat protein gene";
RL   J. Plant Pathol. 89(2):281-285(2007).
XX
RN   [2]
RP   1-669
RA   Papayiannis L., Santos C., Kyriakou A., Nolasco G.;
RT   ;
RL   Submitted (13-MAR-2007) to the EMBL/GenBank/DDBJ databases.
RL   FERN, Univ. Algarve, Faro 8005-139, Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .669
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="CY93-10"
FT                   /mol_type="genomic RNA"
FT                   /country="Cyprus"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .>669
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ABQ42903.1"
FT                   /translation="MDDETKKLKNKNKETKEGDNVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNVALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 669 BP; 190 A; 121 C; 176 G; 182 T; 0 other;

ef491676 Length: 669  23-MAY-2007  Type: N  Check: 4328  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacaat gttgttgcag cggagtcttc tttcggttct gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg tcgctttgaa cagggatttg tttcttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgacgacact
     301  acgggtataa cgtacactcg ggagggcgtc gaagtggaat tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt aggactaacg atgcccttta tttagccttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc ggatttcttg accggagctg
     551  gcttgactga tttagagtgt gctgtgtaca tacaagctaa agaacaatta
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgt