Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CY92-365 coat protein gene, partial cds.

ACC No: EF491678

Dated: 2007-05-23 | Length: 669 | CRC: -2118566752

                
ID   EF491678; SV 1; linear; genomic RNA; STD; VRL; 669 BP.
XX
AC   EF491678;
XX
DT   23-MAY-2007 (Rel. 91, Created)
DT   23-MAY-2007 (Rel. 91, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CY92-365 coat protein gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-669
RA   Papayiannis L., Kyriakou A., Santos C., Nolasco G.;
RT   "Molecular characterization of Citrus tristeza virus (CTV) isolates from
RT   Cyprus on the basis of the coat protein gene";
RL   J. Plant Pathol. 89(2):281-285(2007).
XX
RN   [2]
RP   1-669
RA   Papayiannis L., Santos C., Kyriakou A., Nolasco G.;
RT   ;
RL   Submitted (13-MAR-2007) to the EMBL/GenBank/DDBJ databases.
RL   FERN, Univ. Algarve, Faro 8005-139, Portugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .669
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="CY92-365"
FT                   /mol_type="genomic RNA"
FT                   /country="Cyprus"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .>669
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ABQ42905.1"
FT                   /translation="MDDETKTLKNKNKETKEGDGVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDATGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYKQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 669 BP; 194 A; 126 C; 170 G; 179 T; 0 other;

ef491678 Length: 669  23-MAY-2007  Type: N  Check: 1286  ..

       1  atggacgacg aaacaaagac attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacggt gttgtagctg ccgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactttgata acgatgaacg atgtgcgtca gttgggcacc
     151  caacagaacg ctgctttgaa cagagactta ttccttactt tgaaagggaa
     201  gtatcctaac ttacctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga tgacgacgcc
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgtctgataa
     351  actttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgcagacaga atcgcaattt gagttatggc ggacgtccgc tagacgcagg
     501  gattccggcc gggtatcatt acttgtgtgc ggatttcttg actggagctg
     551  gtttgactga cttagaatgt gctgtgtaca aacaagctaa agaacaatta
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgt