Sequence of DPV Pelargonium leaf curl virus

Pelargonium leaf curl virus coat protein gene, complete cds.

ACC No: EF532328

Dated: 2011-12-21 | Length: 1206 | CRC: 523967786

                
ID   EF532328; SV 1; linear; genomic RNA; STD; VRL; 1206 BP.
XX
AC   EF532328;
XX
DT   10-SEP-2007 (Rel. 93, Created)
DT   21-DEC-2011 (Rel. 111, Last updated, Version 3)
XX
DE   Pelargonium leaf curl virus coat protein gene, complete cds.
XX
KW   .
XX
OS   Pelargonium leaf curl virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1206
RA   Rasoulpour R., Izadpanah K.;
RT   "Isolation and Partial Characterization of Pelargonium leaf curl virus,
RT   Moroccan pepper virus";
RL   J. Phytopathol. 159:802-804(2011).
XX
RN   [2]
RP   1-1206
RA   Rasoulpour R., Izadpanah K.;
RT   ;
RL   Submitted (31-MAR-2007) to the INSDC.
RL   Plant Pathology, Plant Virology Research Center, Shiraz, Fars 98 0711, Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1206
FT                   /organism="Pelargonium leaf curl virus"
FT                   /host="Pelargonium hortorum (geranium)"
FT                   /strain="G"
FT                   /mol_type="genomic RNA"
FT                   /country="Iran"
FT                   /collected_by="R. Rasoulpour"
FT                   /collection_date="Sep-2006"
FT                   /identified_by="R. Rasoulpour and K. Izadpanah"
FT                   /db_xref="taxon:35280"
FT   CDS             19. .1188
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ABP96987.1"
FT                   /translation="MAMVRRNNNTSIIPVTGMQLATIVGTAVAGAVGNVVKNNGGAIAR
FT                   TAVGFGKQVVKRFRRRKGGGNQQMIQHVGGTGGAVMAPVAVTRQLMGSKPKFTGRMSGS
FT                   VTVTHREYLTQVNNTTAFAVNGGIVDNLLQLNPLNGTLFAWLPAIASNFDQYTFNNVVL
FT                   HYVPLCATTEVGRVAMYFDKDSEDVEPADRVELANYGVLKETAPWAEATLNIPCDRIKR
FT                   YCDDNATVDHKLIDLGQLGIATYGGSGTNAIGDVFISYSVTLYYPQPTNSLLSTRRLDL
FT                   TGASLNGNGPGYTIVSRTPTVISMTFRSTGTFVLTGAYRCLTASTLGLTGSVNVNSITV
FT                   LDTLGLATSFIINCTVSSLPSVVSFTSTGITSATINCVRATRANVVTLA"
XX
SQ   Sequence 1206 BP; 329 A; 266 C; 296 G; 315 T; 0 other;

ef532328 Length: 1206  21-DEC-2011  Type: N  Check: 4428  ..

       1  acacaactag agaagataat ggcaatggta cgtagaaata acaacacatc
      51  aattatacca gtcactggca tgcagttggc aactattgtt ggcactgcgg
     101  tagctggagc tgtcggaaat gtcgtgaaga acaatggtgg ggcaatagcg
     151  agaacagccg ttggttttgg gaagcaagta gtaaaaagat ttagaagaag
     201  aaaaggagga ggaaatcagc agatgataca acatgtaggt ggtacaggtg
     251  gggcagttat ggccccggtg gcagtgacta gacaactcat gggaagtaag
     301  cctaaattca caggtagaat gtctggatct gtcacagtaa cccaccgtga
     351  gtacctaact caggtcaata acaccactgc gtttgcggta aatgggggga
     401  ttgtcgacaa tttgttacag ctcaacccgt tgaatgggac actgttcgca
     451  tggttaccgg ctatagcctc taactttgac cagtacacat tcaacaatgt
     501  tgtgctacat tatgtacccc tgtgcgccac cactgaggtg ggacgtgtgg
     551  caatgtactt tgataaggac tcggaggatg ttgaacctgc tgatagagtt
     601  gagttggcta attacggagt gctcaaagag acagccccct gggctgaagc
     651  aaccctgaat atcccttgtg atcggattaa gagatactgt gatgacaatg
     701  ctactgtaga tcataaactt atcgacttgg gacagctggg catagctaca
     751  tatggtggct ccgggactaa cgctattgga gatgttttca tttcctatag
     801  tgtcacgtta tattaccctc aacctacgaa ctctctcctt agtactaggc
     851  gccttgatct cacaggtgct tccctcaatg gcaatggacc tggatacact
     901  attgtgtccc gaacacccac tgttatcagt atgaccttca ggtctactgg
     951  cacgtttgtc ttgaccgggg cgtatcggtg cttaactgca tctactctcg
    1001  gacttactgg cagcgtgaat gtgaacagca ttacggtatt ggatacactt
    1051  ggactagcaa ctagtttcat tatcaattgc acagtgtcct cattaccgtc
    1101  tgttgtcagc ttcacatcta ccggcatcac ctctgccacc ataaactgcg
    1151  ttagagctac tagagcaaat gttgttacac tagcataatc ttctctagag
    1201  gggcct