Sequence of DPV Botrytis cinerea mitovirus 1

Botrytis cinerea mitovirus 1 RNA-dependent RNA polymerase (RDRP) gene, complete cds.

ACC No: EF580100

Dated: 2011-01-20 | Length: 2804 | CRC: -1950109872

                
ID   EF580100; SV 3; linear; genomic RNA; STD; VRL; 2804 BP.
XX
AC   EF580100;
XX
DT   04-JUN-2007 (Rel. 92, Created)
DT   20-JAN-2011 (Rel. 107, Last updated, Version 4)
XX
DE   Botrytis cinerea mitovirus 1 RNA-dependent RNA polymerase (RDRP) gene,
DE   complete cds.
XX
KW   .
XX
OS   Botrytis cinerea mitovirus 1
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Narnaviridae;
OC   Mitovirus; unclassified Mitovirus.
XX
RN   [1]
RP   1-2804
RX   DOI; 10.1094/PHYTO-97-12-1590.
RX   PUBMED; 18943720.
RA   Wu M.D., Zhang L., Li G.Q., Jiang D.H., Hou M.S., Huang H.C.;
RT   "Hypovirulence and Double-Stranded RNA in Botrytis cinerea";
RL   Phytopathology 97(12):1590-1599(2007).
XX
RN   [2]
RP   1-2804
RX   PUBMED; 20674953.
RA   Wu M., Zhang L., Li G., Jiang D., Ghabrial S.A.;
RT   "Genome characterization of a debilitation-associated mitovirus infecting
RT   the phytopathogenic fungus Botrytis cinerea";
RL   Virology 406(1):117-126(2010).
XX
RN   [3]
RP   1-2804
RA   Wu M., Zhang L., Li G., Jiang D., Hou M., Huang H.;
RT   ;
RL   Submitted (26-APR-2007) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Huazhong Agricultural University, Shi Zi
RL   Shan, Wuhan, Hubei 430070, China
XX
RN   [4]
RC   Sequence update by submitter
RP   1-2804
RA   Wu M., Zhang L., Li G., Jiang D., Hou M., Huang H.;
RT   ;
RL   Submitted (15-OCT-2008) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Huazhong Agricultural University, Shi Zi
RL   Shan, Wuhan, Hubei 430070, China
XX
RN   [5]
RC   Sequence update by submitter
RP   1-2804
RA   Wu M., Zhang L., Li G., Jiang D., Hou M., Huang H.;
RT   ;
RL   Submitted (05-APR-2010) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Protection, Huazhong Agricultural University, Shi Zi
RL   Shan, Wuhan, Hubei 430070, China
XX
CC   On Apr 5, 2010 this sequence version replaced gi:209514851.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2804
FT                   /organism="Botrytis cinerea mitovirus 1"
FT                   /host="Botrytis cinerea"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /clone="p1R2a"
FT                   /db_xref="taxon:444193"
FT   gene            477. .2693
FT                   /gene="RDRP"
FT   CDS             477. .2693
FT                   /codon_start=1
FT                   /transl_table=4
FT                   /gene="RDRP"
FT                   /product="RNA-dependent RNA polymerase"
FT                   /db_xref="GOA:A5YRF7"
FT                   /db_xref="InterPro:IPR008686"
FT                   /db_xref="UniProtKB/TrEMBL:A5YRF7"
FT                   /protein_id="ABQ65153.3"
FT                   /translation="MKHLFRIKRKAVIKNSTTRLPDHLWLGYVKVLVWLYDIPSAHRTY
FT                   FFELLNRIQSLRRNSGDTWTVGYLKESHRLSSHWLSGNPDVCSGSIRVSVRGLPLIIPG
FT                   RLRNVIYSRNNINITRALLTLLSTFRVMSATPKLKLSTITDPFNGVNETLPSLEVSRAL
FT                   KNILQGNKFHFKKEDIKDPYSVNRLMDITKADPNGGVSLRNVIIDAYALMKHPKVYASL
FT                   LELSNVMSPYLGSLLRNQTTIIRAIIDYDPIEWERIKPFMAPIYQNIKDRTLKLVPDLS
FT                   CIGKLSTKEEAAGKVRVFAMVDIWTQSILNPLHKKIFSIIRELPTDGTFDQLKPLDRLH
FT                   ELSTQDRFSFDLSAATDRLPLTLQKDILTLLVSPSFAEAWGTALVGRPYKWKFGTTEDE
FT                   LMYSVGQPMGALSSWGMLALTHHTIVQVAASRAGYKDLFLDYALLGDDICIANKAVADN
FT                   YLLIMRDLGVEINLSKSLISSTGVVEFAKRWRVGQTDVSPASPALITRLLSNMNYLPVL
FT                   ILDLVNRGVKTIQNSEKLLSLSDSLHKIKKSITFSLIPYYDSEFAKCLLPLKGKDKSFS
FT                   QKELFALYVHTDRIFNKLGLLEFHKAKDGDQENSKLSQSYLYNILDNSKLPLPAITSQI
FT                   DNILIAQMKTITNVPTRNWLNNRDINLLTFECWHSYLIDTLSELSSISKVVPDYTIIKD
FT                   NEKPDNLEMRRNLLFMQELIKDLKKWNPGIFEIIPESILKEEEV"
XX
SQ   Sequence 2804 BP; 960 A; 458 C; 473 G; 913 T; 0 other;

ef580100 Length: 2804  20-JAN-2011  Type: N  Check: 2561  ..

       1  ggcctaacag cgttagctgt taggtgcttt gtagtgatac aaagcatggt
      51  ataacccacc ttcatccact tatattttaa tataagttag tgataatccc
     101  agacttattg acaataagtc gatcaatgga aacattgatg tttttgatat
     151  taatcaaaaa ccaatattgt ttacactgat agtccattct atctattttc
     201  aaaccttaag tggtcagata atagaaccta tcagctatgg tgtatatcac
     251  cccgtcagac aattgtctta ggaagtacta taactaccgt aactggataa
     301  gatgtgaagt tcccttcctt tgtagcttta atgcaattga gactgtcggt
     351  catgaagacc aaacaatata aatattatta atatgcgcac aaaatgggag
     401  aagataccta agcagatgaa ttaatttctg ctaccaatcg gtattttata
     451  gtcaacttta atttaattat aaacaaatga aacatttatt tagaataaaa
     501  agaaaagctg ttataaaaaa tagtactaca cgtttacctg atcatttatg
     551  attaggatat gtgaaggtac ttgtatgatt gtatgatata ccaagcgcac
     601  atcgaaccta tttctttgaa cttctaaaca gaattcaaag tcttaggcgg
     651  aacagtggtg atacttgaac tgtaggatat cttaaagaat cccacagatt
     701  gagttctcac tgactatcag gtaatcctga tgtctgttcc gggtcaattc
     751  gagtttctgt acgaggacta cctttgatta ttccaggtag attaagaaat
     801  gttatatatt ctcgaaataa tattaatatt actcgagcat tgttaacact
     851  cttatctact ttccgtgtaa tgtctgctac gcctaagcta aaacttagca
     901  caataacaga cccatttaat ggagttaatg agactcttcc ttctttggaa
     951  gtttctcgtg ctctaaaaaa tatattacaa ggaaataaat tccattttaa
    1001  gaaagaggat ataaaagatc cttattctgt gaatagactt atggacataa
    1051  caaaagcaga tcctaatggt ggtgtatcac ttcggaatgt tattattgat
    1101  gcatatgcat taatgaaaca tcctaaagta tatgcttcac tattagaatt
    1151  atccaatgta atgtctccat acttaggatc gttattgaga aatcaaacaa
    1201  cgatcataag ggcgattatt gattacgatc ccattgaatg ggaacggatc
    1251  aaacctttta tggctccgat ttatcagaac ataaaagatc gaacacttaa
    1301  actggtgcct gacttaagtt gtataggtaa actatcaact aaagaagagg
    1351  cagcaggaaa agtgagagta ttcgctatgg ttgatatatg aacacagtca
    1401  atattaaatc ctcttcataa gaagatattt agtattatcc gtgaacttcc
    1451  aactgatggt acatttgatc agttgaagcc tttagatcga ttacatgaac
    1501  tatctacaca agatagattc agttttgatt tatcagctgc aacagatcga
    1551  ttacctttga ctcttcaaaa ggatatcctt acattacttg taagtccatc
    1601  ttttgcagag gcttgaggta cagctcttgt cggtagacca tataaatgaa
    1651  aatttggtac tacagaggac gagttgatgt attcagttgg tcaacctatg
    1701  ggggcattat cctcatgagg tatgcttgct ttaactcatc atacgatagt
    1751  tcaagtagca gcctcaagag caggatataa ggacttgttt ctagattacg
    1801  cacttttagg agatgatatc tgtatagcta ataaagctgt agcagataat
    1851  tatcttttaa ttatgcgtga tctaggggtt gagattaacc tatctaaatc
    1901  tttgatttca tcaactggtg ttgttgaatt tgcaaaaaga tgaagagttg
    1951  gacaaacaga tgtttctcca gcttctccag ctttaataac aagattatta
    2001  agtaatatga attaccttcc agtcttgata ttagatttag tgaatagagg
    2051  tgtgaaaacc atccagaatt ctgagaaatt actttctctt tcggattcat
    2101  tgcacaagat taagaaaagt ataacttttt ctttaatccc atactatgat
    2151  tcggaatttg cgaaatgttt actaccctta aaagggaaag ataaatcttt
    2201  ttcacaaaaa gaattatttg ctttatatgt tcatacagac cgaattttta
    2251  ataaattagg tctacttgaa ttccataagg caaaagatgg tgaccaagag
    2301  aattcaaaac tctctcagtc gtatttatat aatatccttg acaatagtaa
    2351  attaccgtta ccggcaatta ctagtcaaat agataatata ttaatagcac
    2401  aaatgaaaac tattactaac gttccaacta ggaactggtt aaataatagg
    2451  gacattaatc tattaacatt tgaatgttga cattcatatt taatagatac
    2501  tctttcagag ttatcttcta tttctaaggt tgtaccggat tacactatca
    2551  ttaaagataa tgaaaaacca gacaacttgg aaatgagacg aaatctcctc
    2601  ttcatgcaag aacttattaa agatcttaag aagtgaaatc cgggtatatt
    2651  tgaaattata ccagaatcca tcctgaaaga ggaagaagtt taatgtgttg
    2701  ctatcattaa acttacagta ttcacatact gtgcattaac cttatttatt
    2751  ttcctttaaa agctgcataa gcaacagtct taggtctata aacggggtta
    2801  atgc