Sequence of DPV Maize white line mosaic virus

Maize white line mosaic virus, complete genome.

ACC No: EF589670

Dated: 2007-06-04 | Length: 4293 | CRC: 87817454

                
ID   EF589670; SV 1; linear; genomic RNA; STD; VRL; 4293 BP.
XX
AC   EF589670;
XX
DT   04-JUN-2007 (Rel. 92, Created)
DT   04-JUN-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Maize white line mosaic virus, complete genome.
XX
KW   .
XX
OS   Maize white line mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Aureusvirus; unclassified Aureusvirus.
XX
RN   [1]
RP   1-4293
RA   Russo M.;
RT   "Sequence Analysis of Maize White Line Mosaic Virus (MWLMV)";
RL   Unpublished.
XX
RN   [2]
RP   1-4293
RA   Russo M.;
RT   ;
RL   Submitted (02-MAY-2007) to the EMBL/GenBank/DDBJ databases.
RL   Istituto di Virologia Vegetale, Sez. Bari, Consiglio Nazionale delle
RL   Ricerche, Via Amendola 165/A, Bari, BA 70126, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4293
FT                   /organism="Maize white line mosaic virus"
FT                   /specific_host="Maize"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /virion
FT                   /db_xref="taxon:445227"
FT   CDS             41. .2434
FT                   /codon_start=1
FT                   /transl_except=(pos:863. .865,aa:OTHER)
FT                   /product="RNA directed-RNA polymerase"
FT                   /note="p92; contains readthrough stop codon; ORF2"
FT                   /protein_id="ABQ65750.1"
FT                   /translation="MALARGVLSQRVVTAAVDVTFGSVDYSDPRIVAALCDGGLKGRAT
FT                   VRRQIVTALKWLVMVLTWPVRMPAMAIVWCLTWVALMVTRTTRKICCVVSRLYSESSAL
FT                   VRAYWRVYNKRTRAVACTGLVGSLALYGPAAVLVWVCLLVVFVFCTLPADARYYIKLAK
FT                   KIQDAWDAVEEDDSITPAADGGPLEVRSGRNRFACRLAARAISRVGLLKPTKANALVYQ
FT                   KVILDEMKVLNVRFGDRVRVLPLAVVACLERPDAVDRVEGVIDALTCLPGSLXGGLVRR
FT                   EGCDTDTDRTKFDLSAVQGVTRMEGITVRTGTSAKGGRTWYSFNSPATTYEYIVHNSSL
FT                   KNVVRGLVERVFCVVDKKTGELVRPPKPVKGLFTKKLGDVGQVVSQLVGYCPHWTRQEF
FT                   LASYNGPRKASYERAALTLDTLPLREEDAHLSTFVKAEKINVTLKPDPAPRVIQPRGQR
FT                   YNIEVGRFLKPLEPRLMKAIDKLWGSTTAIKGYTVERVGAIMNEKANRFREPVFVGLDA
FT                   SRFDQHCSAEALRWEHSVYNDIFRSEYLATLLQWQVNNRGTAYTKEGTVSYKVEGCRMS
FT                   GDMNTSMGNYLIMSCLIYAFCREVRLKAELANCGDDCVLFLEKEDLHKLGTLPQWFVRM
FT                   GYTMKVEEPVYEVEHIEFCQMRPIRTSRGWVMVRRPDTVLTKDCCVVRGGMTEERLKGW
FT                   LGSMRDGGLSLAGDVPILGAFYRSFPSYASQEASEYSAPHKFRAGKQYGAVTDESRYSF
FT                   WLAFGLTPDDQLAVESELSKMAFHTRPEQKGPYQPSLLDYCTRT"
FT   CDS             41. .865
FT                   /codon_start=1
FT                   /product="p30"
FT                   /note="pre-readthrough region of RNA directed-RNA
FT                   polymerase; ORF1"
FT                   /protein_id="ABQ65749.1"
FT                   /translation="MALARGVLSQRVVTAAVDVTFGSVDYSDPRIVAALCDGGLKGRAT
FT                   VRRQIVTALKWLVMVLTWPVRMPAMAIVWCLTWVALMVTRTTRKICCVVSRLYSESSAL
FT                   VRAYWRVYNKRTRAVACTGLVGSLALYGPAAVLVWVCLLVVFVFCTLPADARYYIKLAK
FT                   KIQDAWDAVEEDDSITPAADGGPLEVRSGRNRFACRLAARAISRVGLLKPTKANALVYQ
FT                   KVILDEMKVLNVRFGDRVRVLPLAVVACLERPDAVDRVEGVIDALTCLPGSL"
FT   CDS             2489. .3487
FT                   /codon_start=1
FT                   /product="virus coat protein"
FT                   /note="CP; ORF3"
FT                   /protein_id="ABQ65751.1"
FT                   /translation="MARKKRSNQVQTGQGVRRAAGAVITAPVARTRQVRARPPKVEALA
FT                   GGGFRVTHRELITTIANSATYQANGGIAGLKYRMNPTYGSTLTWCPALASNFDQYVFRK
FT                   LTLEYVPTCGTTETGRVGIWFDRDSEDDPPADRVELASMGVLVETAPWSGVTLQVPTDN
FT                   TKRFCLGAGGNTDAKLIDLGQIGFSTYAGAGTNAVGDLFAEYVVDLHCPQPSGALVQTL
FT                   RITSAGVRGPEVGPLYYNMTKAATLIDLTFFTPGTFLISIGCAATSYTSELVLGGATLN
FT                   SRTLTATGAGFSGSFNVTVTKPLDGLRIQGTGFGDCMTFAVRARVANSVTV"
FT   CDS             3524. .4207
FT                   /codon_start=1
FT                   /product="movement protein"
FT                   /note="MP; ORF4"
FT                   /protein_id="ABQ65752.1"
FT                   /translation="MSIISLDGEFDCPPYQPTSSRFHFTHKTRKSAICIGPSTFGKLWR
FT                   VPRAGYYTPTDVTFVVTPHISEKAGVMATVKLIDASDMSPSRVLFETKAFNLGHGTVLE
FT                   GSQLPFCLPIGEYPIHFEVTVSRSQFRGERTMYSTSLEWQMMCSPTPLSRVRSVFAVAH
FT                   QPVLDAVPNFSMKTKKKSSVLSGGKGQATEKRILAGGGTARGVVPPGCVAPAEGIPVIA
FT                   TIEDH"
FT   CDS             3652. .4068
FT                   /codon_start=1
FT                   /product="silencing suppressor protein"
FT                   /note="p15; ORF5"
FT                   /protein_id="ABQ65753.1"
FT                   /translation="MASPEGWVLHPNRCDLCGYATYLRESWRYGDCQTHRRIRHEPIPS
FT                   AVRDQGVQPWPWDGTGGVSIAVLPANRGISYTLRGHGVTITVSGRTDNVLNITRVANDV
FT                   FSHPVIQGSICVRGCAPTSVGCGPEFLNENQKEV"
XX
SQ   Sequence 4293 BP; 970 A; 1072 C; 1259 G; 992 T; 0 other;

ef589670 Length: 4293  04-JUN-2007  Type: N  Check: 4278  ..

       1  agaatacctc ctggatctaa ccaatccgtg agagttggcc atggccttgg
      51  ctagaggtgt tctctcccag cgcgtcgtga cggcggcagt tgacgttact
     101  tttggtagtg ttgactacag tgacccacgc attgtggcag cactgtgtga
     151  tgggggtttg aaggggcggg cgaccgtaag gcgtcaaatt gtaactgcgc
     201  tcaaatggct agtgatggtg ctcacttggc ccgtaaggat gcccgcgatg
     251  gcgatcgtgt ggtgtctgac atgggtagca ctgatggtca ctcgaaccac
     301  caggaagatc tgctgtgtcg ttagcaggtt gtactccgag tcctccgcct
     351  tagtccgtgc atactggcgt gtgtacaata aaaggactag ggccgtggct
     401  tgcactggcc tggtgggttc cctggcactg tacggccctg ctgctgtgtt
     451  ggtgtgggtg tgtcttctag tggtgttcgt cttttgtaca ctaccggctg
     501  atgcccgata ctacatcaaa ttggccaaga aaatacagga tgcttgggac
     551  gcggttgagg aggatgacag catcacccca gccgctgatg gtggaccact
     601  ggaggttcgc tccgggcgga accggttcgc gtgccgactg gcagcgaggg
     651  caatcagtcg tgtgggcttg ttgaagccca ctaaggcaaa cgctctcgtg
     701  taccagaagg ttatcctcga cgagatgaaa gtgctcaacg tccggttcgg
     751  tgaccgagta cgagtgctgc cacttgccgt ggtcgcgtgt ctggaacggc
     801  ccgatgctgt ggatagggtt gagggggtca ttgacgccct cacctgtctg
     851  cctggcagcc tctagggagg ccttgtccgc cgtgaagggt gcgacaccga
     901  cactgaccgc acaaaatttg atctatcagc ggttcagggg gtgacacgca
     951  tggagggaat cacggtacgg acagggacct cagccaaagg tgggagaact
    1001  tggtactcgt tcaactcacc ggcaacgaca tatgagtaca ttgtccacaa
    1051  ctcatcactt aagaacgtag tcaggggact tgtcgagcgg gtcttctgtg
    1101  ttgtggacaa gaaaactggt gaactggtcc ggcccccaaa acctgttaag
    1151  gggctattca ccaagaagct cggtgacgtc ggtcaagtag tgagtcaact
    1201  cgttggttat tgcccccact ggacacgtca agaattcttg gcgtcttaca
    1251  atgggccgcg aaaagccagt tacgagcggg ctgcgctaac gctagacact
    1301  ctgcccttgc gtgaggagga tgcgcatctg agcacctttg taaaggcgga
    1351  gaagatcaac gtcactctga aacctgatcc tgccccacga gtgattcagc
    1401  cgcgtggaca gcggtacaac attgaggtgg gaaggtttct gaaacccctg
    1451  gaaccacgcc taatgaaggc gatcgataag ctgtgggggt ccaccacagc
    1501  tattaagggg tacacggttg agagagtcgg ggctatcatg aatgagaaag
    1551  ctaacagatt tcgtgagcct gtgtttgtgg gtttagatgc ctctcggttt
    1601  gaccaacatt gttctgccga ggcccttaga tgggaacaca gtgtttacaa
    1651  cgacatcttt cgatctgagt atctcgcaac actcttacag tggcaggtca
    1701  acaatagagg gactgcctac actaaagagg gtactgtgag ttacaaggta
    1751  gaagggtgcc gtatgtctgg ggacatgaac acgtcgatgg gaaattattt
    1801  aatcatgtcc tgcttgatct atgccttttg ccgggaagtt agactgaaag
    1851  cggaattggc taactgtggt gacgattgcg tgctgttttt ggagaaagag
    1901  gatcttcaca agcttggcac tttaccgcag tggtttgtac gtatgggata
    1951  tacgatgaag gtggaggagc cggtgtatga ggtggagcac attgagttct
    2001  gccaaatgcg ccccattcgc acctccagag gatgggtcat ggtcaggcgt
    2051  ccggacactg ttctaacaaa ggattgttgt gttgtcaggg gaggaatgac
    2101  tgaggagcgg ttgaagggat ggcttggtag tatgcgcgat ggcggtctca
    2151  gccttgctgg ggacgtaccc atattgggtg ccttctaccg gtccttccca
    2201  tcatacgctt ctcaggaagc ttccgagtac agcgccccac acaagttccg
    2251  ggcgggtaag cagtacggcg ctgtcacaga cgagagccgg tattcctttt
    2301  ggctggcgtt tgggctcaca cccgacgacc agcttgctgt ggagagtgaa
    2351  ttgtcaaaga tggcgtttca tactcgtccg gagcaaaaag gaccgtacca
    2401  gccctcgcta cttgactact gcactagaac ctgaccagtt caccagccac
    2451  cttgactact gcactagaac ctgaccagtt caccagccat ggcgaggaag
    2501  aagcggagca accaggtaca gacgggacag ggagtgaggc gagcagcagg
    2551  ggctgtcatt acagctcctg tagctaggac ccgacaagtg agggcccggc
    2601  cacctaaggt cgaggcgtta gcgggcggtg gttttcgggt cacccatagg
    2651  gagttgatca ctaccattgc caactcggct acataccagg cgaacggggg
    2701  tattgctgga ttaaagtaca ggatgaatcc gacgtacggc tccaccttga
    2751  cgtggtgtcc ggccttggca tccaacttcg accagtatgt cttccgcaaa
    2801  ttgaccttgg aatacgtgcc gacgtgtggg acaacggaga cggggagggt
    2851  gggcatctgg ttcgataggg actctgaaga tgacccgcct gctgaccgag
    2901  tggaattggc tagtatgggg gtacttgtgg agactgctcc atggagcggt
    2951  gtcacactac aggtacccac ggacaacacc aagagattct gcctcggcgc
    3001  tggtggcaac acggatgcca aactgataga ccttggtcaa atcggtttta
    3051  gtacgtacgc gggagctggg acgaacgctg tcggtgatct attcgccgag
    3101  tatgtcgtgg atctacactg cccgcaaccg tctggcgcat tagtccaaac
    3151  gttgcgaatc actagtgctg gggtgcgagg acctgaagtt ggaccactat
    3201  actacaacat gacaaaggca gcaactctca ttgacctgac gttcttcaca
    3251  ccaggcacat ttctgatctc aataggctgc gcagctactt cgtatacttc
    3301  ggagctagtc ctgggaggag ccacgctgaa ctcacgaaca ctcactgcca
    3351  caggagccgg gttttccggg tcctttaacg tcactgtgac caagccctta
    3401  gatggcttac gcatacaagg aaccggattc ggtgactgta tgacgtttgc
    3451  tgtccgcgcg agggtggcca actctgttac tgtctagctg tggctggctg
    3501  gaggataaga agctaaccac ttcatgtcga taatcagtct tgacggagag
    3551  tttgattgtc ctccttatca acccacctca tcccgctttc acttcactca
    3601  caaaacgcgc aagtctgcta tttgtatcgg tccttctact ttcggcaaat
    3651  tatggcgagt cccgagggct gggtattaca ccccaaccga tgtgaccttt
    3701  gtggttacgc cacatatctc cgagaaagct ggcgttatgg cgactgtcaa
    3751  actcatagac gcatccgaca tgagcccatc ccgagtgctg ttcgagacca
    3801  aggcgttcaa ccttggccat gggacggtac tggaggggtc tcaattgccg
    3851  ttttgcctgc caatcgggga atatcctata cacttcgagg tcacggtgtc
    3901  acgatcacag tttcggggag aacggacaat gtactcaaca tcactcgagt
    3951  ggcaaatgat gtgttctccc accccgttat ccagggttcg atctgtgttc
    4001  gcggttgcgc accaaccagt gttggatgcg gtcccgaatt tctcaatgaa
    4051  aaccaaaaag aagtctagcg tcctgtccgg tggtaagggt caagcgacag
    4101  aaaagaggat tttggctggt ggtggtacgg cccggggagt ggttcccccg
    4151  ggatgcgtag cgccagctga aggaatccca gtaatcgcca ctatagaaga
    4201  ccactaggac agcatgtact ccacgcttcg gcggggctat aaggagtaca
    4251  tgataccccc ccctatcttt cacccagctt gctggggtag ccc