Sequence of DPV Carnation mottle virus

Carnation mottle virus isolate FO25 coat protein gene, partial cds.

ACC No: EF622206

Dated: 2008-01-01 | Length: 1044 | CRC: 1987343675

                
ID   EF622206; SV 1; linear; genomic RNA; STD; VRL; 1044 BP.
XX
AC   EF622206;
XX
DT   01-JAN-2008 (Rel. 94, Created)
DT   01-JAN-2008 (Rel. 94, Last updated, Version 1)
XX
DE   Carnation mottle virus isolate FO25 coat protein gene, partial cds.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1044
RA   Huang C.H., Chen C.C., Chen L.W., Chiang F.L., Cheng Y.H., Chang C.A.;
RT   "Nucleotide sequence of the coat protein region of Carnation mottle virus
RT   infecting calla lily";
RL   Unpublished.
XX
RN   [2]
RP   1-1044
RA   Huang C.H., Chen C.C., Chen L.W., Chiang F.L., Cheng Y.H., Chang C.A.;
RT   ;
RL   Submitted (22-MAY-2007) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, Taiwan Agriculture Research, 189 Chung-Cheng Road, Wu
RL   Feng, Taichung 41301, Taiwan ROC
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1044
FT                   /organism="Carnation mottle virus"
FT                   /specific_host="Zantedeschia (calla lily)"
FT                   /isolate="FO25"
FT                   /mol_type="genomic RNA"
FT                   /isolation_source="bulbs imported from New Zealand"
FT                   /db_xref="taxon:11986"
FT   CDS             1. .>1044
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ABU96113.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAILAFTPRRPRMTNPPPRTSRNSSGQAGKSMTMSKTELLCTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGSVEGGFTKPTLIGPGISGDVDYESARPIAICELVTQMEGQILKITKTSAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1044 BP; 294 A; 246 C; 282 G; 222 T; 0 other;

ef622206 Length: 1044  01-JAN-2008  Type: N  Check: 8182  ..

       1  atggaaaata aaggagaaaa gatcgcgatg aatcccactg tgcaaacgtt
      51  ggcgcagaag ggggacaagt tagccgtgaa gttggtgaca agagggtggg
     101  cctctctgag tacgaaccag aagaggagag ctgaaatgct tgctggatac
     151  actccagcga tcctagcctt tactccccga cgaccacgga tgacgaaccc
     201  tcctccaaga accagtagga attcatcagg acaagctgga aagtccatga
     251  cgatgagtaa gaccgaacta ctatgcaccg tcaaaggtac cacgggtgtt
     301  atcccaagct ttgaagactg ggtcgtttcc ccccgaaacg tagccgtctt
     351  ccctcaactc tcgctgctag cgacgaactt caacaagtac cgcatcactg
     401  cgcttactgt gaagtactca cccgcgtgca gtttcgagac caatgggagg
     451  gtggctctgg gattcaacga tgacgcttcg gacacaccgc caaccaccaa
     501  ggttggtttt tacgatctgg gcaaacatgt ggaaactgct gcacagacag
     551  ctaaggatct agtgatacca gtagacggca aaacccggtt catcagggac
     601  tcggctagtg atgatgccaa actagtcgat tttgggcgaa tagtcttgtc
     651  aacatacggg tttgacaagg ctgacactgt ggtgggcgaa ttgtttatac
     701  agtacacgat tgtgctgagt gacccaacca agacggccaa aatttcacag
     751  gcaagcaacg ataaggtgtc ggacggacca acgtatgtgg tcccttcggt
     801  taatggcaac gagctacaat tacgagtggt agctgctggg aaatggtgca
     851  ttatagtgcg gggttcggtt gagggaggct tcaccaaacc cacacttatt
     901  gggccaggaa tcagcggtga tgtggactat gaaagtgcca gacctatcgc
     951  catttgtgag ttggtgacac aaatggaggg ccagatattg aaaatcacca
    1001  aaacctcagc agaacaacca ctccaatggg ttgtttatag gatg