Sequence of DPV RD114 retrovirus

RD114 retrovirus isolate SC3C, complete genome.

ACC No: EU030001

Dated: 2007-08-05 | Length: 8406 | CRC: 1608764611

                
ID   EU030001; SV 1; linear; genomic DNA; STD; VRL; 8406 BP.
XX
AC   EU030001;
XX
DT   05-AUG-2007 (Rel. 92, Created)
DT   05-AUG-2007 (Rel. 92, Last updated, Version 1)
XX
DE   RD114 retrovirus isolate SC3C, complete genome.
XX
KW   .
XX
OS   RD114 retrovirus
OC   Viruses; Retro-transcribing viruses; Retroviridae; Orthoretrovirinae;
OC   Gammaretrovirus; unclassified Gammaretrovirus.
XX
RN   [1]
RP   1-8406
RA   Ghani K., Caron M.-C., Caruso M.;
RT   "RD114-based retroviral vectors for gene therapy";
RL   Unpublished.
XX
RN   [2]
RP   1-8406
RA   Ghani K., Caron M.-C., Caruso M.;
RT   ;
RL   Submitted (11-JUL-2007) to the EMBL/GenBank/DDBJ databases.
RL   Medical Biology, Laval University, 9, rue McMahon, Quebec, QC G1R 2J6,
RL   Canada
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .8406
FT                   /organism="RD114 retrovirus"
FT                   /isolate="SC3C"
FT                   /mol_type="genomic DNA"
FT                   /country="USA"
FT                   /proviral
FT                   /db_xref="taxon:11834"
FT   LTR             1. .482
FT   gene            947. .6166
FT                   /gene="gag"
FT   CDS             947. .6166
FT                   /codon_start=1
FT                   /transl_except=(pos:2597. .2599,aa:Glu)
FT                   /gene="gag"
FT                   /product="gag-pol precursor polyprotein"
FT                   /protein_id="ABS71856.1"
FT                   /translation="MGQTLTTPLTLTLTHFSDVQARAHNLSLEVRKGRWRTYCSSEWPT
FT                   LSVGWPRDGTFDLSIILQVKTKVMDPGPRGHPDQIAYILTWEDLIRNPPAWVKPFLPSC
FT                   PLSQSTLLPLKTSKDRASTQPSAPPKPPKPVLPDESQKDPPLLDALSSPPHNPLLQPPP
FT                   YNPPLAPALTPVGPTSPPASSSSSLSPTSSPACTSAPSSTPAPPDLTPQTPPQTPRLRL
FT                   RRLDDPNGPPTWQSSLFPLRTVNRTVQYWPFSASDLYNWKTHNPSFSQEPQALTSLIES
FT                   ILLTHQPTWDDCQQLLQVLLTTEERQRVLLEARKNVPGPGGFPTQLPNEIDEGFPLTRP
FT                   DWDYETAPGRESLRIYRQALLAGLKGAGKRPTNLAKVRTIIQGKEESPAAFMERLLEGF
FT                   RMYTPFTPEAPEHKATVAMSFIDQAASDIKGKLQRLDGIQTYGLQELVREAEKVYNKRE
FT                   TPEEKEARLAKEQEAREERRDRKRDKHLTKILAAVVTENRTGKSGETKRRPKIEKDQCA
FT                   YCKERGHWIKDCPKRPRDSKKSTPVLTLGEESEEGRQGSGAPPEPRLTLSVGGHPTTFL
FT                   VDTGAQHSVLTKANGPLSSRTSWVQGATGRKIHKWTNRRTVDLGQGTVTHSFLVVPECP
FT                   YPLLGRDLLTKLGAQIHFSETGAQVLNRDGQPIQVLTVSLHDEHRLFETPVTTNLLEAW
FT                   LQDFPQAWAETGGLGRAKCQAPIIIDLKPTAMPVSIRQYPMSKEAHMGIQPHITRFLEL
FT                   GVLRPCRSPWNTPLLPVKKPGTRDYRPVQDLREVNKRTMDIHPTVPNPYNLLSTLSPDR
FT                   TWYTVLDLKDAFFCLPLAPQSQELFAFEWRDPERGISGQLTWTRLPQGFKNSPTLFDEA
FT                   LHRDLTDFRTQHPEVTLLQYVDDLLLAAPTEEACTRGTKHLLRELGDKGYRASAKKAQI
FT                   CQTKVTYLGYILSEGKRWLTPGRIETVARIPPPQSPREVREFLGTAGFCRLWIPGFAEL
FT                   AAPLYALTKESAPFTWQEKHQSAFEALKEALLSAPALGLPDTSKPFTLFIDEKQGIAKG
FT                   VLTQKLGPWKRPVAYLSKKLDPVAAGWPPCLRIMAATAMLVKDSAKLTLGQPLTVITPH
FT                   ALEAIVRQPPDRWITNARLTHYQALLLDTDRVQFGPPVTLNPATLLPAPKDQQSAHDCR
FT                   QVLAETHGTREDLKDQELPDADHSWYTDGSSYIDSGTRRAGAAVVDGHHIIWAQSLPPG
FT                   TSAQKAELIALTKALELSEGKKANIYTDSRYAFATAHTHGSIYERRGLLTSEGKEIKNK
FT                   AEIIALLKALFLPRRVAIIHCPGHQKGQDPIATGNRQADQVARQVAVAETLTLTKLEET
FT                   NLTTNKYAYTPEDQEEAKAIGAILNQDTKDWEKEGKIVLPRKEALAMIQQMHAWTHLSN
FT                   RKLKSLIEKTDFLIPKAGTLIEQVTSACKVCQQVNAGATRVPEGKRTRGNRPGVYWEID
FT                   FTEVKPHYAGYKYLLVFVDTFSGWVEAYPTRQETAHVVAKKILEEIFPRFGLPKVIGSD
FT                   NGPAFVSQVSQGLARTLGINWKLHCAYRPQSSGQVERMNRTIKETLTKLTLETGLKDWR
FT                   RLLSLALLRARNTPNRFGLTPYEILYGGPPPLSTLLNSFSPSDPKTDLQARLKGLQAVQ
FT                   AQIWTPLAELYRPGHPQTSHPFQVGDSVYVRRHRSQGLEPRWKGPYIVLLTTPTAIKVD
FT                   GIAAWIHASHAKAAPKTPGPETPKTWKLRRSENPLKIRLSRV"
FT   CDS             6201. .7898
FT                   /codon_start=1
FT                   /product="envelope glycoprotein"
FT                   /protein_id="ABS71857.1"
FT                   /translation="MKLPTGMVILCSLIIVRAGFDDPRKAIALVQKQHGKPCECSGGQV
FT                   SEAPPNSIQQVTCPGKTAYLMTNQKWKCRVTPKNLTPSGGELQNCPCNTFQDSMHSSCY
FT                   TEYRQCRANNKTYYTATLLKIRSGSLNEVQILQNPNQLLQSPCRGSINQPVCWSATAPI
FT                   HISDGGGPLDTKRVWTVQKRLEQIHKAMHPELQYHPLALPKVRDDLSLDARTFDILNTT
FT                   FRLLQMSNFSLAQDCWLCLKLGTPTPLAIPTPSLTYSLADSLANASCQIIPPLLVQPMQ
FT                   FSNSSCLSSPFINDTEQIDLGAVTFTNCTSVANVSSPLCALNGSVFLCGNNMAYTYLPQ
FT                   NWTGLCVQASLLPDIDIIPGDEPVPIPAIDHYIHRPKRAVQFIPLLAGLGITAAFTTGA
FT                   TGLGVSVTQYTKLSHQLISDVQVLSGTIQDLQDQVDSLAEVVLQNRRGLDLLTAEQGGI
FT                   CLALQEKCCFYANKSGIVRNKIRTLQEELQKRRESLASNPLWTGLQGFLPYLLPLLGPL
FT                   LTLLLILTIGPCVFSRLMAFINDRLNVVHAMVLAQQYQALKAEEEAQD"
FT   LTR             7925. .8406
XX
SQ   Sequence 8406 BP; 2236 A; 2488 C; 1902 G; 1780 T; 0 other;

eu030001 Length: 8406  05-AUG-2007  Type: N  Check: 9744  ..

       1  tgagaagtca gaacccccca cctttgctac ataaataacc gctttcattt
      51  cgcttctgta aaaccgctta tgcgccccac cctaaccgct ttcatttcgc
     101  ttctgtaaaa ccgcttatgc gccccaccct agccggaaag tccccagccg
     151  ctacgcaacc cgggccccga gttgcatcag ccgcttcgca acccgggctc
     201  cgagttgcat cagccgaaag aaacttcatt tcccaagctt ccccgggacg
     251  aaattaccca caaccccaac caccaccgag cagagagcct atcgccagcc
     301  tgtatgcaaa tgtaactcaa aatggtataa aagacctgta accccgttta
     351  tcggggctct cccgctttct aacactgggg agccctggtg caccagtaaa
     401  gactctctgc cgacgtcgga gtgccgcgtg gttctttgcg ccaactctca
     451  ttccataggg cctaggagtt tggctcctaa catttggtgc attggccggg
     501  aaaccgaggg aaggcaagag aaccccggcc ccgtcggtgg atgactctcc
     551  ggcccgggcc actgacggac tgactgaaga cagacttctg tgcctttgtc
     601  tgcacacagg tattgtgttc tatgttttgt ctctgaactg tgaattctga
     651  ggccggccgg ccacctccgt aggagtgttg aaggaggaca gacgtgtcct
     701  gaaccttcac accccagccc cgagggacgc ctcggtggtg tttgtagggg
     751  agaactgaca agttcgtcag actccccaaa tccgtaggca ggcctcccct
     801  gccatctgaa tctgaatact ggccgcggct ccttggttat tgtctagtct
     851  gtgttgtctg gtctgtgtcg acattgtagt catctttgtg tatgtgtgtg
     901  taagtgtgct ggtgtggacg cgtggacagg acaggacgac acagccatgg
     951  gacagacatt gactactcct ctaactttga ctctgactca tttctcggac
    1001  gtccaagcaa gagctcacaa tctttccctt gaggttcgga aaggtcgatg
    1051  gcgaacttat tgttcatcag agtggcccac cctatccgta gggtggcccc
    1101  gggatgggac ttttgacctc tctattatat tacaggttaa gacgaaggta
    1151  atggatcccg gaccacgagg tcatccagat caaatagcct atatcctcac
    1201  gtgggaggat ctcattcgga atcctccggc atgggtgaaa cccttcctcc
    1251  cttcctgccc cctatctcag tctacccttc tccccctgaa aacctcaaaa
    1301  gaccgagcct caacccaacc ttcagcccca cccaaaccgc ccaaaccagt
    1351  tcttcctgat gagtcccaaa aggaccctcc tctcctagac gctttgtcct
    1401  cgccgcctca caaccccctc ctacagcctc caccctataa tccgcccctg
    1451  gcccccgcct tgaccccggt gggccctacg tcccctcctg cctccagttc
    1501  ctcctccctc tccccaactt cttcccccgc ctgtacgtca gccccgtcct
    1551  ctaccccagc cccacccgat ctaactcccc agaccccacc tcagaccccc
    1601  cgcctccgtc tccggcgatt ggatgaccca aacggccctc ccacttggca
    1651  atcttccctg tttcctcttc ggacagtcaa ccggactgtc caatattggc
    1701  cattctctgc ctccgatctt tataattgga aaactcataa cccttccttt
    1751  tcccaagaac cccaggccct aacctcactg atagaatcca tcctcctcac
    1801  acaccagccc acctgggacg actgccagca actcctacag gtccttttga
    1851  ctacagagga aaggcaacga gttctcctgg aggcccggaa aaatgtgcca
    1901  gggcctggag gctttccaac ccagctcccc aatgaaatag atgaggggtt
    1951  tccccttact cgcccggact gggactatga aacggctcca ggtagggaga
    2001  gtctccgaat ctatcgccag gctctgttgg cgggtctcaa gggggcagga
    2051  aaacggccca ccaatttggc caaggtaaga actataattc aaggaaaaga
    2101  ggaaagcccc gcagccttta tggaacggct tctagagggg tttcggatgt
    2151  atactccatt tacgcccgaa gctccagaac ataaggctac agtggccatg
    2201  tcgttcatag atcaggcagc atccgatata aaaggaaaac tccaaaggtt
    2251  agatgggatc caaacctatg ggttgcaaga actagttagg gaggcagaaa
    2301  aggtatataa caagagggaa actccagaag aaaaggaggc taggctagca
    2351  aaagagcagg aagcacggga ggaacgaaga gatcgaaaga gagataaaca
    2401  tctaactaaa atcctggcag ctgtagtgac agaaaataga acaggaaagt
    2451  caggggaaac gaagaggcgg cccaaaatag aaaaagacca atgtgcctat
    2501  tgcaaagagc gcgggcactg gatcaaagac tgccctaagc gccctagaga
    2551  ctcaaagaaa tctacccccg tactcacctt gggcgaagag agcgagtagg
    2601  gacgtcaggg ctctggagcc ccccccgagc cccggctaac tttatctgta
    2651  ggggggcatc ccaccacctt cctggtggac acgggagctc aacactcggt
    2701  cttaaccaag gcaaatgggc ccctgtcctc gcgtacctcc tgggtccaag
    2751  gagcgacagg aaggaaaatt cacaaatgga ctaaccgccg cacggttgac
    2801  ctagggcaag ggacagtgac acactccttt ctggtggtac ccgaatgccc
    2851  gtaccccctt ctgggacgag acctcctgac caagcttgga gcccagatac
    2901  acttctccga aacgggggcc caagtgctaa accgggatgg ccagcctatc
    2951  caagtcttga ctgtgtcctt acacgacgaa catagacttt ttgaaacccc
    3001  ggtcaccact aacctcctcg aagcctggct gcaggacttt ccccaggcct
    3051  gggcagaaac gggagggctc ggtcgagcca aatgtcaggc cccaatcata
    3101  attgacctaa agcccacggc aatgcctgta tctatcagac agtatcccat
    3151  gagcaaggag gctcatatgg gcattcagcc acacattacc aggtttctag
    3201  agcttggggt cctgcgacct tgccgctcac cttggaatac ccctctctta
    3251  ccagtgaaaa aacctggtac tcgggactac aggcccgtcc aagacttaag
    3301  ggaagtcaac aaaaggacta tggatatcca tcctacggtc cccaatccct
    3351  ataacttgct cagcactctg agcccagacc gcacctggta cacagtactg
    3401  gacctaaaag atgcattctt ttgcttaccc ttggcccccc agagccagga
    3451  actgtttgct ttcgaatgga gggaccctga aagaggaatc tcaggccaat
    3501  taacctggac ccgcttaccc caggggttca aaaactcccc cactctcttt
    3551  gatgaggctc tccacaggga cctaactgac ttccggactc aacacccaga
    3601  agtaactcta ctccaatatg tggatgacct tcttctggcc gcccccacag
    3651  aggaagcctg cacacgaggt accaaacatc tgcttcgaga attgggagac
    3701  aaaggatacc gggcatccgc taagaaggcc cagatttgcc aaaccaaagt
    3751  aacctatctg gggtacatac taagtgaggg gaaaagatgg ctcacccctg
    3801  ggcgaataga aactgtggct cgcattccgc cgccccagag ccccagagag
    3851  gtacgtgaat tcctgggaac tgctgggttc tgtcgcttat ggatacctgg
    3901  gttcgctgag ctagccgccc ccctctatgc cctcacgaaa gagagtgcac
    3951  ccttcacctg gcaggaaaaa catcagtcag cctttgaggc cctaaaagag
    4001  gccctccttt ccgccccggc tctcgggttg ccagacacct ccaagccctt
    4051  taccctcttc atagacgaga aacaaggaat tgccaaagga gttctaaccc
    4101  aaaaactagg gccctggaag agaccagtag catacctgtc caaaaagttg
    4151  gaccctgtgg cagcggggtg gcccccatgt cttcgtatca tggcagccac
    4201  tgctatgctg gtcaaggact ctgccaaatt aacccttgga cagccactaa
    4251  ctgttatcac cccgcatgct ttagaggcca tagtgcggca accaccagac
    4301  cgatggataa ccaacgcacg cctaactcac taccaggccc tcctactgga
    4351  cacagaccgc gtccaatttg gacctccggt taccttgaac cctgccacgt
    4401  tgctaccggc accgaaagac caacagagcg cacacgattg tcggcaagta
    4451  ctggctgaga cccatgggac acgggaagat cttaaagatc aagagctccc
    4501  agatgcggat cactcttggt atacggacgg gagcagttac atcgactcag
    4551  gtacccggag ggcgggagcg gcggtagtag atggccacca catcatatgg
    4601  gcacaatcac tacctcctgg cacgtctgcc caaaaggctg agctgatagc
    4651  actcaccaag gccctagagc tatccgaagg gaaaaaggct aacatatata
    4701  cagatagccg atatgccttt gcaacggctc atacacatgg gagtatttat
    4751  gaaagaaggg gcctactaac ctcagaagga aaagaaatta aaaataaagc
    4801  tgaaatcatt gcattattaa aggccctttt tcttccccgg agagtagcca
    4851  taattcattg ccccgggcat cagaaaggac aagacccaat tgcaacagga
    4901  aatagacagg cagaccaagt agccaggcaa gtcgctgtgg cagaaacgtt
    4951  gactttgacc aagcttgaag aaaccaatct tacgaccaac aaatatgctt
    5001  acaccccaga agaccaggaa gaggcaaagg ccataggggc tatactgaat
    5051  caggacacta aagactggga aaaagaagga aagatagtcc ttccccgaaa
    5101  ggaagcccta gcaatgatcc aacaaatgca cgcctggaca catttaagta
    5151  atcggaagct gaagtcactg attgaaaaga ctgacttctt aatccctaag
    5201  gcaggcaccc tcatagaaca ggtgacctcc gcctgtaagg tctgtcaaca
    5251  ggtaaacgct ggggctaccc gagtgccaga aggaaaacgg actcgtggta
    5301  accgcccagg agtctattgg gaaatagatt ttactgaagt aaagcctcac
    5351  tatgcggggt ataagtacct attagtgttt gtagacacct tttcaggatg
    5401  ggtagaagcc taccccaccc gacaggaaac ggcacacgtg gtagccaaga
    5451  agattttaga agaaatcttc cccagatttg gacttcccaa ggtaatcggg
    5501  tcagataacg ggccggcctt cgtttcccag gtaagtcagg ggctcgccag
    5551  gacactgggg attaattgga aattacactg tgcatatagg ccccagagct
    5601  caggacaggt agaaagaatg aatagaacaa taaaagagac ccttactaaa
    5651  ttgaccttag agactggctt aaaagattgg agacgcctcc tatctctggc
    5701  tttgttaaga gccagaaata cgcccaaccg tttcgggctc accccatatg
    5751  aaatccttta tgggggaccc ccccctttgt caaccttgct caattccttc
    5801  tccccctccg atcctaagac tgatttacaa gcccgactaa aagggctgca
    5851  agcggtgcag gcccaaatct ggacacccct ggccgaattg taccggccag
    5901  gacatccaca aactagccac ccatttcagg tgggagactc cgtgtacgtc
    5951  cggcggcacc gctctcaagg attggagcct cgttggaagg gaccttacat
    6001  cgtcctgctg accacgccca ccgccataaa ggttgacggg atcgccgcct
    6051  ggattcacgc atcgcacgcc aaggcagccc caaaaacccc tggaccagaa
    6101  actcccaaaa cctggaagct ccgccgttcg gagaaccctc ttaagataag
    6151  actctcccgt gtctgactgc taatccacct tgtccctgta ctaacccaaa
    6201  atgaaactcc caacaggaat ggtcatttta tgtagcctaa taatagttcg
    6251  ggcagggttt gacgaccccc gcaaggctat cgcattagta caaaaacaac
    6301  atggtaaacc atgcgaatgc agcggagggc aggtatccga ggccccaccg
    6351  aactccatcc aacaggtaac ttgcccaggc aagacggcct acttaatgac
    6401  caaccaaaaa tggaaatgca gagtcactcc aaaaaatctc acccctagcg
    6451  ggggagaact ccagaactgc ccctgtaaca ctttccagga ctcgatgcac
    6501  agttcttgtt atactgaata ccggcaatgc agggcgaata ataagacata
    6551  ctacacggcc accttgctta aaatacggtc tgggagcctc aacgaggtac
    6601  agatattaca aaaccccaat cagctcctac agtccccttg taggggctct
    6651  ataaatcagc ccgtttgctg gagtgccaca gcccccatcc atatctccga
    6701  tggtggagga cccctcgata ctaagagagt gtggacagtc caaaaaaggc
    6751  tagaacaaat tcataaggct atgcatcctg aacttcaata ccacccctta
    6801  gccctgccca aagtcagaga tgaccttagc cttgatgcac ggacttttga
    6851  tatcctgaat accactttta ggttactcca gatgtccaat tttagccttg
    6901  cccaagattg ttggctctgt ttaaaactag gtacccctac ccctcttgcg
    6951  atacccactc cctctttaac ctactcccta gcagactccc tagcgaatgc
    7001  ctcctgtcag attatacctc ccctcttggt tcaaccgatg cagttctcca
    7051  actcgtcctg tttatcttcc cctttcatta acgatacgga acaaatagac
    7101  ttaggtgcag tcacctttac taactgcacc tctgtagcca atgtcagtag
    7151  tcctttatgt gccctaaacg ggtcagtctt cctctgtgga aataacatgg
    7201  catacaccta tttaccccaa aactggacag gactttgcgt ccaagcctcc
    7251  ctcctccccg acattgacat catcccgggg gatgagccag tccccattcc
    7301  tgccattgat cattatatac atagacctaa acgagctgta cagttcatcc
    7351  ctttactagc tggactggga atcaccgcag cattcaccac cggagctaca
    7401  ggcctaggtg tctccgtcac ccagtataca aaattatccc atcagttaat
    7451  atctgatgtc caagtcttat ccggtaccat acaagattta caagaccagg
    7501  tagactcgtt agctgaagta gttctccaaa ataggagggg actggaccta
    7551  ctaacggcag aacaaggagg aatttgttta gccttacaag aaaaatgctg
    7601  tttttatgct aacaagtcag gaattgtgag aaacaaaata agaaccctac
    7651  aagaagaatt acaaaaacgc agggaaagcc tggcatccaa ccctctctgg
    7701  accgggctgc agggctttct tccgtacctc ctacctctcc tgggacccct
    7751  actcaccctc ctactcatac taaccattgg gccatgcgtt ttcagtcgcc
    7801  tcatggcctt cattaatgat agacttaatg ttgtacatgc catggtgctg
    7851  gcccagcaat accaagcact caaagctgag gaagaagctc aggattgagc
    7901  ttccgggaca aaagcagggg ggaatgagaa gtcagaaccc cccacctttg
    7951  ctacataaat aaccgctttc atttcgcttc tgtaaaaccg cttatgcgcc
    8001  ccaccctaac cgctttcatt tcgcttctgt aaaaccgctt atgcgcccca
    8051  ccctagccgg aaagtcccca gccgctacgc aacccgggcc ccgagttgca
    8101  tcagccgctt cgcaacccgg gctccgagtt gcatcagccg aaagaaactt
    8151  catttcccaa gcttccccgg gacgaaatta cccacaaccc caaccaccac
    8201  cgagcagaga gcctatcgcc agcctgtatg caaatgtaac tcaaaatggt
    8251  ataaaagacc tgtaaccccg tttatcgggg ctctcccgct ttctaacact
    8301  ggggagccct ggtgcaccag taaagactct ctgccgacgt cggagtgccg
    8351  cgtggttctt tgcgccaact ctcattccat agggcctagg agtttggctc
    8401  ctaaca