Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate L/I major capsid protein gene, complete cds.

ACC No: EU053126

Dated: 2007-08-06 | Length: 597 | CRC: -471015749

                
ID   EU053126; SV 1; linear; genomic RNA; STD; VRL; 597 BP.
XX
AC   EU053126;
XX
DT   06-AUG-2007 (Rel. 92, Created)
DT   06-AUG-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate L/I major capsid protein
DE   gene, complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-597
RA   Radaelli P., Fajardo T.V.M., Eiras M., Pio Ribeiro G., Kuniyuki H.;
RT   "Detection and molecular characterization of the Grapevine
RT   leafroll-associated virus 2 coat protein gene";
RL   Unpublished.
XX
RN   [2]
RP   1-597
RA   Radaelli P., Fajardo T.V.M., Eiras M., Pio Ribeiro G., Kuniyuki H.;
RT   ;
RL   Submitted (24-JUL-2007) to the EMBL/GenBank/DDBJ databases.
RL   Laboratorio de Virologia, Embrapa Uva e Vinho, Rua Livramento, 515, Bento
RL   Goncalves, RS 95700-000, Brasil
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .597
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /specific_host="grapevine cv. Isabel grafted on cv. LN33"
FT                   /isolate="L/I"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /db_xref="taxon:64003"
FT   CDS             1. .597
FT                   /codon_start=1
FT                   /product="major capsid protein"
FT                   /protein_id="ABS76288.1"
FT                   /translation="MELMSDSNLSNLVITVASSLNGVDKKLLSAEVVKMLVQKGAPNEG
FT                   IEVVFGLLLYALAARTTSPKVQRADSDVIFSNSFGERNVVATEGDLKKVLDGCAPLTRF
FT                   TNKLRTFGRTFTEAYVDFCIAYQHKLPQLNAAAELGIPAEDSYLAADFLGTCPKLSELQ
FT                   QSRNMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
XX
SQ   Sequence 597 BP; 159 A; 124 C; 159 G; 155 T; 0 other;

eu053126 Length: 597  06-AUG-2007  Type: N  Check: 860  ..

       1  atggagttga tgtccgacag caaccttagc aacctggtga taaccgtcgc
      51  ctctagtcta aatggtgtcg acaagaagct tttatctgct gaagttgtaa
     101  aaatgttggt gcagaaaggg gctcctaacg agggtataga agtggtgttc
     151  ggtctactcc tttacgcact cgcggcaaga accacgtctc ctaaggttca
     201  gcgcgcagat tcagacgtta tattttcaaa tagtttcgga gagaggaatg
     251  tggtagcaac agagggtgac cttaagaagg tactcgacgg gtgtgcgcct
     301  ctcactaggt tcactaataa acttagaacg ttcggtcgta ctttcactga
     351  ggcttacgtt gacttttgta tcgcgtatca gcacaaatta ccccaactca
     401  acgccgcggc ggaattgggg attccagctg aagattcgta cttagctgca
     451  gattttctgg gtacttgccc gaagctctct gaattgcagc aaagtaggaa
     501  catgttcgcg agtatgtacg ctctaaaaac tgaaggtgga gtggtgaata
     551  caccagtgag caatctgcgt cagctgggta gaagggaagt tatgtaa