Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate B165, complete genome.

ACC No: EU076703

Dated: 2010-07-08 | Length: 19247 | CRC: -1453525606

                ID   EU076703; SV 3; linear; genomic RNA; STD; VRL; 19247 BP.
XX
AC   EU076703;
XX
DT   22-JAN-2008 (Rel. 94, Created)
DT   08-JUL-2010 (Rel. 105, Last updated, Version 3)
XX
DE   Citrus tristeza virus isolate B165, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19247
RX   PUBMED; 20381550.
RA   Roy A., Brlansky R.H.;
RT   "Genome analysis of an orange stem pitting citrus tristeza virus isolate
RT   reveals a novel recombinant genotype";
RL   Virus Res. 151(2):118-130(2010).
XX
RN   [2]
RP   1-19247
RA   Roy A., Brlansky R.H.;
RT   "Genomic sequence of Citrus tristeza virus from India represents a new
RT   genotype";
RL   Unpublished.
XX
RN   [3]
RP   1-19247
RA   Roy A., Brlansky R.H.;
RT   ;
RL   Submitted (24-JUL-2007) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Pathology, University of Florida, 700, Experimental
RL   Station Road, CREC, ED, Lake Alfred, FL 33850, USA
XX
RN   [4]
RC   Sequence update by submitter
RP   1-19247
RA   Roy A., Brlansky R.H.;
RT   ;
RL   Submitted (23-APR-2008) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Pathology, University of Florida, 700, Experimental
RL   Station Road, CREC, ED, Lake Alfred, FL 33850, USA
XX
RN   [5]
RC   Sequence update by submitter
RP   1-19247
RA   Roy A., Brlansky R.H.;
RT   ;
RL   Submitted (11-DEC-2008) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Pathology, University of Florida, 700, Experimental
RL   Station Road, CREC, ED, Lake Alfred, FL 33850, USA
XX
DR   RFAM; RF00193; CTV_rep_sig.
XX
CC   On Dec 11, 2008 this sequence version replaced gi:185250110.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19247
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus reticulata cv. Ellendale"
FT                   /isolate="B165"
FT                   /mol_type="genomic RNA"
FT                   /country="India"
FT                   /note="genotype: VT"
FT                   /db_xref="taxon:12162"
FT   5'UTR           1. .107
FT   CDS             108. .9449
FT                   /codon_start=1
FT                   /product="polyprotein p349"
FT                   /note="ORF1a"
FT                   /db_xref="GOA:B8PRP6"
FT                   /db_xref="InterPro:IPR000606"
FT                   /db_xref="InterPro:IPR002588"
FT                   /db_xref="InterPro:IPR008749"
FT                   /db_xref="InterPro:IPR022054"
FT                   /db_xref="InterPro:IPR022108"
FT                   /db_xref="InterPro:IPR022239"
FT                   /db_xref="UniProtKB/TrEMBL:B8PRP6"
FT                   /protein_id="ACC77709.2"
FT                   /translation="MSRLGASFGSSAFAVRSDYTISRIWRAFNAIGVLHFFGDGKITKV
FT                   IKEFSAAGPIVPLRKSCFPFTVRAAVRAIRAAGRPIDAPRSGCLCGLPVFDASGVVRPR
FT                   SVAGVWRFSLCKPPLTTAAKRSLRKAKKDSVSFPSRASSLFSRRVPRGMRRRLRRRVMN
FT                   RVNPTVHESPQDKNRNKGRQHGKASALPYMGEAALDDILRWIEGVNPPPSMVAIPVPIS
FT                   FGAMPTTAWCSPADAAVLRCRLDYHAAETSFRNEGKHVRYVYNDVSSAANRPRTVSPRK
FT                   CGRVFPSGSALGVEVPSTRDRHTAFVRSTHASVFFSDAVRRVRMFRPARNNFFTSVVSG
FT                   RRVCYYRPGPNGTVSVLMSDGANTARLDVVAPAYYAYAKALGAKARCLWESSDLDDAKV
FT                   RDGQCYVRHVYDVALYYGRRVDLSMCRTLGMYPTVGALKVLLTREYGRDSLKVPMRGTY
FT                   TFGSVFHCLSTKQWVDLRTIPNHHLVGGNSAQILIGQIRVDVAGSVAKPSRSAIRRRNR
FT                   RLRKDGFIGSSESSSSGWSRHCSDCSTPRAPPSPSVLKPNLGRIPSINRKFRYPVGTQL
FT                   NVSIPKRADDRVYVSIGQDFDDLCHSVCTYVKRYDSRKSFYTRFENGEDFIVLRRASVG
FT                   GLHVFTKRGSCTARFPLTASRYEAKYDEYMKDYDLSWVKKDRHLDVEVIRRRRSGVSRR
FT                   SAGPPSVGTRVSSDQQSEPTEAVPTLVEDYSPCRDALSSQPGVGSAWFKVNSPNRCART
FT                   VRERHSTNKGKIGDFDFPRGTVYNAHVDESAYKRVLKLRDTSASSFLRIVLARLSSYRP
FT                   LSDEFFNKCVTSRFVVCVEAVESGLVTVHFRSDVFRASFPFGVHLYTRHAFDIYSGKLL
FT                   ALDTYGFSEDLRDGYCYIRHIAEVCLSMGRIFFRRDVHLGAYPYVFEVQHRLERLYGKL
FT                   ALKYGVRGYYSASRLYHCSYSDSPRPMKLLNKYHKMGGEDGPLLITDTDRLRAVGSAYE
FT                   KVKGRLPDSLLVRSVEKDLIEFNQTLVDAQRARPGVVVPFQMSENQQVMLTRAYPEFNI
FT                   NFTHSVHSDHPVAAGSRALENDLVRKYAGRDYSDVGGCPLFHLRAGHSGVHVCRPVYDI
FT                   EDAHRRVIRHHQLRRVELDHTDGSKQVGAVNTNSVCGNVLGECFHASDAIVMVQVYDVP
FT                   LRELCRAMINKKASVCYMTVVTPGELLDARESFFIKELDCSVELDTVADKVVYCFSNSA
FT                   YTHTYSTIREYMCTPCVVVDGFLFTVEMVSLRCSVNYYCITKSRVCPRISETKRLRYRR
FT                   CDSDLIRIKIPRYSSKTRSRLPGCYYLYLDAKFVSRVYEYVVNNCVVVNAKTFEWTWNH
FT                   IKSCKSRVVISGKIIHRDVPIALEYLDGFSAVMLSAGVKGRQNAEAFSRRLAAFSGDTS
FT                   LFELVRFAISEKCRDLFVGIQEAVERYVKSYLRNSFNMSFVDLSDPLLTISEYSELDVP
FT                   IDLPGFGSMTEGDEAKLIEDGVKSALLRKAVQDEARLIIGQGGTSEIVPCGDDEESGGD
FT                   NSDRSHKADSDSTSSTSSGGLRAGAAPSLFRCLLKKLGGGFCLARKILDLLCEKVIRSF
FT                   SQLKCGTFRLTSFLNTLRAKFSCHFFDDSIFVTVWEIILNLFRIVNGVTKTKLGCLRNV
FT                   FRLIPRLYSGCKDFVKTVGDMYKDIALFSAEFFSKSYTKLCRFSLEVFDVGLIEISARN
FT                   MGLETCVSMASAIFDVVLTYPLGSISFPVVCARVFGALAMEVGSNYCFKKTFGKPEILG
FT                   EDAFRRTVSMVLSAKAFDKLSIDGKGLVRCSGVIPGVLRIVFSSLFSDADAWVGYSKHE
FT                   VSSLPIITYSAKKLSFALEQTKEACIAFIVDSSKRILASLTSEIHESFQNSELTNGAKS
FT                   LYGHVSSVLSVSNGVVSKAGNAVAAVKAAGSGLSKRVRRIRPSFRLARCVNEQTSEYYS
FT                   ASDESELDESLLSDTPGLRGNGKCNDLFRVVSGRVLVCCRRAVEALKRLVLHVGDCLYS
FT                   RIMDSFVRLFVETNVAVGKCESFAVDCTRKVSDLVIGYITWRNLHSGAYSTTPGLSGGS
FT                   RNSLSRFLDGGLTCVIRNIVTAWLTVFDETFYLSLVHRMRTASINVLLEFLKNLPVCLV
FT                   SIYTFMECRSRIFPLKEFLWGFCVFVWNIVKELSICIYGSLPVCVTRLCNRAFRRSSNE
FT                   GDVRTLQVITEAENRIEFLREVLAEMARYRASLEIPVPGSPDSPLFPPTYGEIEELGND
FT                   SSDSARLIGVDNGSGSVPTEGEAELDSDGDSDDSIPLDRDFEQIGGLGGSGNVDVFRLG
FT                   LKFVWRMLRNLFNLRAVKLSYGLALQCIFNGGSMGQFTSRLLFSFGNCLPFELFRHVCS
FT                   VRWLSKSLALRIRNASICDEETVEHFFSFSRFLYDSRYLSDVFSVLERVDFYLSYLFSL
FT                   PKRCLTRNRSVRVCARAPVRVIRNVGLVEDGKKSLTEVLNSLDSLKVSDRKGKSALIES
FT                   DGSDSESGHSFGSISFGSVNEEVLEAVNGGVVSEKAPLMKHAAALSRLEPDLSGNKDLP
FT                   IVRRSFTRGESSGTKPPGSLCVYLTTLNSSFGSVPDLYPVARDITYKKMTNAMREFYYS
FT                   QKVTLYELHGKLSSYWDELKTVGFDRKLAKMDLDDDVSVVDFNLKVIVGRHGTRPFRNT
FT                   VNSHEFMFCDDGLVLCPGPKKRDFALISSQTQFVAANSFLRAVDGKDLTFTNSEHSLIV
FT                   YEAPPGGGKTHSLVTYFTDYCTKVSCLVVTANKNSQAEISQRISKELMDRKMVAKHVIK
FT                   TASRVFTVDSYLMNHIHLKTELLFVDECFMVHAGAIGAIVEFTSCKAVVFFGDSRQIHY
FT                   IHRNDFGVSLLHDIDAFIQPEHRVYGEVSYRCPWDICEWLSKFYPRHVATANIASVGKS
FT                   SVSIEIINGYDDVPYESDAKYVVYTQAEKNELQKHLGRLTVGRTKTVPIVNTVHEVQGE
FT                   TYKRVRLVRCKYQEDTPFCSDNHVVVALTRHVDSLVYSVLNSRRYDKTASSIDEAREIF
FT                   DKFRSANHSHGSSSLEWYLEKYPNEYKGSKASSVPLSCINEFLNEVVVGSSVVQLGDTS
FT                   EELSSQPFESGCDNVTIRDTAPPDSGNLHEPARVRRGKVTGNSAKKSVSTRKSSVIRKS
FT                   "
FT   CDS             <9280. .10806
FT                   /codon_start=1
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="ORF1b; expressed through +1 ribosomal frameshift
FT                   from ORF1a"
FT                   /db_xref="GOA:B0F3U3"
FT                   /db_xref="InterPro:IPR001788"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:B0F3U3"
FT                   /protein_id="ABW97532.1"
FT                   /translation="ALNPLSLVVTTSLLGTLPLQILVTYTNRLVFGVVRSQAIPPRKAS
FT                   LQENLLSYESRNYNFIKTERYVGPENFGRAMAAAVLDRCFKMEEVAKIRSDIIALTEAN
FT                   IAKWLDKRTPCQVKSVQAELKLPFAAEEQITNYKLMVKRDAKVKLDDSCLSKHPAAQNI
FT                   MFHKKFINAIYSPCFDEFKNRVLSSLNRNIVFFTEMTNAGLAEVIRRIIGDDDDLFVGE
FT                   VDFSKFDKSQDLFIKEYERSLYSEFGFDDELLDLWMEGEYRARATTLDGQLSFSVDGQR
FT                   RSGGSNTWIGNSLVTLGILSLYYDVSKFELLLISGDDSLIYSRAPISNFSSEICLETGF
FT                   ETKFMSPSVPYFCSKFVVQTGNKTCFIPDPYKLLVKLGAPQYKLTDDELFELFTSFKDI
FT                   TQDFGDQVVLEKLKFLVEAKYGFTSGTTMPALCAIHCVRSNYLSFERLFPFIRGWYVVD
FT                   ALKLRQLRKFANLICERVVYDNRVGYFSYFDNPFTKPDASDGQADDLATG"
FT   CDS             10855. .11766
FT                   /codon_start=1
FT                   /product="33 kDa protein"
FT                   /note="ORF2"
FT                   /db_xref="InterPro:IPR010803"
FT                   /db_xref="UniProtKB/TrEMBL:B0F3U4"
FT                   /protein_id="ABW97531.1"
FT                   /translation="MFAFASENQDILEEKIFRRRTCHRKYLGDVVGDFTIDVGYNAADR
FT                   DPTVLADYFSLYFFLLNNDNIGPLAASIVVSPPVNGTHKIRAHVDNQPNREGNVTYVKT
FT                   VDKSRFVIRIKAMPASTRGYYSFRTFVSGDIASERSEFMCSFVGSRYLCCCTQTISENL
FT                   SNVCSSSFFFRAVSETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPHPPRCYRNNNLG
FT                   DSSGVQSRTIEEEGYRTDTVSNVTVTIPNTPLVNAVSPYVAEFNENTRSRVSLIRRVCC
FT                   YAVCVLVVSLLIMSGLIAIIFI"
FT   CDS             11837. .11992
FT                   /codon_start=1
FT                   /product="6 kDa small hydrophobic protein"
FT                   /note="ORF3; required for virus movement"
FT                   /db_xref="InterPro:IPR009584"
FT                   /db_xref="UniProtKB/TrEMBL:A2ID09"
FT                   /protein_id="ABW97530.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNASPY
FT                   GTHATI"
FT   CDS             11998. .13782
FT                   /codon_start=1
FT                   /product="65 kDa protein"
FT                   /note="ORF4; similar to HSP70h; required for virion
FT                   assembly"
FT                   /db_xref="GOA:B0F3U6"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:B0F3U6"
FT                   /protein_id="ABW97529.1"
FT                   /translation="MVLLSLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLATSGEPGSFYKDLKRWVGCTEKNYQSYLHKLSPSYKVIVKEFGIKSMP
FT                   VPYLSPLNNDLGLSVALPSLIALYTKSILSDAERVFNVSCTGVVCSVPAGYNTLQRAFT
FT                   QQSVSLSGYTCVYIINEPSAAAYSTLPKLSSADKYLAVYVFGGGTFVVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDRKLSDKIYELADFLPQKELNVSSLKEALSLQTDPVKYTVTHYG
FT                   MSETVSIDQTTLREIASVFITRTVDILTQVKAKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LETVPFVSGIVPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPNDVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSHYDYVGMPHPTRKLLRLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDTLLADLRKTASLSEYSKKYPITRNDIDVLSSRM
FT                   GIVVSKVLRGSDLERVPL"
FT   CDS             13706. .15316
FT                   /codon_start=1
FT                   /product="61 kDa protein"
FT                   /note="ORF5; required for virion assembly"
FT                   /db_xref="InterPro:IPR004909"
FT                   /db_xref="UniProtKB/TrEMBL:B0F3U7"
FT                   /protein_id="ABW97528.1"
FT                   /translation="MCFHHVWGSLFRKFYGEAIWKEYLSESTRNFDERNISLDHTLSSG
FT                   VVVRRQNLLNAPQGTFENELALLYNSVVINDFVELTGMPLKSLMTGVEDRKIPDELISV
FT                   DPHEVGCRFTLNDVESYLISRGEDSADVTAVEHSWCLSNSCGRLLSSTEIDTYKTMVFT
FT                   KTFDSGVFGVTTKLETYLSYCISLYKKHCMKDDDYFNLILPMFNCLMKVLASLGLFYEK
FT                   YTDNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWNISEPDDPADER
FT                   TLVPFDPTDFVLDIPKLNIHDTMVVVGNQIRHLEHVVESDALDDLSQHVDLNLAADNPD
FT                   LRVDLRWAGMFVYYGVYRCAVDRVVERPALFNLPRKLLSQDDGESCLLRMSSVETLFNL
FT                   VQKVNKDINIRRQFMGRHSKVALRLYRNLGLKFPPISSVRLPAHHGYLYVDFYKRIPDN
FT                   AVDADELESLRQLRSSVDVMCKDRVSVTPPPFNRHRRGSSRILRGRGARGASSRYMSRD
FT                   VATSGFNLPFHHGGLHDAS"
FT   CDS             15291. .16013
FT                   /codon_start=1
FT                   /product="27 kDa minor coat protein"
FT                   /note="ORF6"
FT                   /db_xref="GOA:B0F3U8"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:B0F3U8"
FT                   /protein_id="ABW97527.1"
FT                   /translation="MAGYTMLPKTDDKEMDPVSAAVPGKYPDVIEKFVTNRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFAGEQLKYVMVTMDTFLLENYKTKAEDLLVHLAMIQKRLCTI
FT                   STSTKTKYRDKGCISYVQGGLRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CTARLRPDLYENKRTTKAGTPHLKGYLSADFLTGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16105. .16776
FT                   /codon_start=1
FT                   /product="25 kDa major coat protein"
FT                   /note="ORF7"
FT                   /db_xref="GOA:O10474"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:O10474"
FT                   /protein_id="ABW97526.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
FT   CDS             16742. .17245
FT                   /codon_start=1
FT                   /product="18 kDa protein"
FT                   /note="ORF8"
FT                   /db_xref="InterPro:IPR008452"
FT                   /db_xref="UniProtKB/TrEMBL:B0F3V0"
FT                   /protein_id="ABW97525.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRFLSGWWSFIVNVGEIIVRFALHVPSE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVVDRLESMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVIMGINVDDSRCGCSIWFYNNGTFQNGLTRCNNLVAL
FT                   FSAT"
FT   CDS             17279. .17638
FT                   /codon_start=1
FT                   /product="13 kDa protein"
FT                   /note="ORF9"
FT                   /db_xref="InterPro:IPR009692"
FT                   /db_xref="UniProtKB/TrEMBL:B0F3V1"
FT                   /protein_id="ABW97524.1"
FT                   /translation="MGIRRVWLKVMAVITVLWYGKEPSISEGYNALMNDDFKFIDAHFS
FT                   NVSYAKKCYELANFDLDFLRIVIIPLSGGAVNESRADRANVSEIVESHMSDRDRMKVLL
FT                   RNKRIQIPSLLPCDN"
FT   CDS             17714. .18262
FT                   /codon_start=1
FT                   /product="20 kDa protein"
FT                   /note="ORF10; forms inclusion bodies"
FT                   /db_xref="InterPro:IPR021742"
FT                   /db_xref="UniProtKB/TrEMBL:B0F3V2"
FT                   /protein_id="ABW97523.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYMSSSHTSFESVMRTELKLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVSTVCGQFDINLVSPSCV"
FT   CDS             18345. .18974
FT                   /codon_start=1
FT                   /product="23 kDa regulatory protein"
FT                   /note="ORF1; required for asymmetric RNA accumulation;
FT                   RNA-binding protein"
FT                   /db_xref="InterPro:IPR006893"
FT                   /db_xref="UniProtKB/TrEMBL:B0F3V3"
FT                   /protein_id="ABW97522.1"
FT                   /translation="MDDTSGQTFISVNLSDESNTASTETKAVSSEVDRLEFLRKMNPFI
FT                   IDALIRKNSYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKREARAFSNAEMFAIDLVMHTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPNINAVDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
FT   3'UTR           18975. .19247
XX
SQ   Sequence 19247 BP; 4730 A; 3836 C; 4945 G; 5736 T; 0 other;

eu076703 Length: 19247  08-JUL-2010  Type: N  Check: 6525  ..

       1  aatttctcaa attcacccgt accctccgga aaatacgtcc ggacgctgca
      51  ggatttggtg taggtccagc cttaggctca gctaccccca tgcaaaccta
     101  attatacatg tcgagactcg gagctagctt cgggtcctcg gctttcgctg
     151  tacgcagcga ttatactatt tcgcgcatct ggcgcgcttt taatgccatt
     201  ggagtcctgc acttctttgg cgatggtaaa atcactaagg tgattaagga
     251  gttttcggct gctgggccga ttgtcccatt acggaaatcc tgttttccgt
     301  ttactgttcg cgctgctgtt cgcgcgattc gtgccgccgg acgtcccatt
     351  gacgctccgc gctctgggtg cctctgtggt ctccctgttt tcgacgcatc
     401  tggcgtcgtg cgtccccgct ctgttgcggg cgtttggagg ttttctctgt
     451  gcaagcctcc cctaactact gccgctaaga ggtccctccg taaggcaaag
     501  aaggattctg tttcctttcc tagccgggct tcttcactct tctctcgaag
     551  agtccctcgc ggcatgcgtc gtagacttcg ccgacgcgtg atgaaccgag
     601  tgaacccaac cgtgcatgaa agtccccaag acaagaacag aaacaaggga
     651  cgccagcatg gcaaggcttc tgccctcccg tacatgggag aagcggcgtt
     701  ggatgatatc cttcgctgga ttgagggggt aaatcccccg ccgtcgatgg
     751  tcgccattcc ggtgcccatc tctttcggcg ccatgcccac aacggcatgg
     801  tgctctcctg ctgacgcggc tgttttgcgg tgtcgtttag actaccacgc
     851  cgctgagact tcctttcgta acgaagggaa gcacgtgaga tacgtctata
     901  atgacgtgtc ttctgctgcc aaccgtcctc gtacggtttc tccccgcaag
     951  tgcgggcgtg ttttccccag cggttccgcg ctgggcgttg aggtcccgag
    1001  cactagggat cgccataccg ctttcgtgag atctactcac gctagcgttt
    1051  tcttctccga cgcggttcgc cgcgttcgca tgttccgtcc tgcgcggaat
    1101  aattttttca ctagcgtcgt cagtgggcgg cgagtttgtt actatagacc
    1151  cgggcctaat ggtacggtgt ctgttctaat gtcggacggc gccaatacag
    1201  cgcgtctcga cgttgtcgct cctgcgtatt acgcgtacgc taaagccttg
    1251  ggtgccaaag ctcgttgctt gtgggagtcg tctgacttgg acgacgctaa
    1301  agtgcgtgac ggtcaatgtt acgttcgtca cgtgtacgac gtggctctct
    1351  attatgggag gcgcgttgac ctttctatgt gccgcacttt gggtatgtat
    1401  cccacagtgg gtgccttaaa agttttactc actcgcgagt atggtcgcga
    1451  ctctttaaag gttccaatgc gcgggaccta cacctttggt agtgtttttc
    1501  actgcctgtc gaccaaacaa tgggtcgact tgagaactat tcctaaccat
    1551  cacttggttg gtggtaactc tgctcaaatt ttaatcgggc agattcgtgt
    1601  cgacgtcgct gggagcgtcg ctaaaccgtc ccgatcagcc attcgtaggc
    1651  gtaacaggcg cctgcgaaaa gatggtttta tcggcagttc cgagtcctct
    1701  tcgtcggggt ggtcgaggca ctgttcggat tgttctactc ctcgcgctcc
    1751  gccctctcct tcggttttga aacccaatct cggtagaata ccgagtataa
    1801  accggaagtt ccgatacccg gtgggaactc agctgaacgt ttctatccct
    1851  aaacgtgctg atgaccgggt gtacgtgtca atcggtcagg attttgatga
    1901  tttgtgccac tcggtttgta cctatgttaa aaggtatgat tcgaggaagt
    1951  ccttctatac gcgttttgaa aatggtgaag attttatcgt tcttcgacgc
    2001  gcttctgtcg ggggcctcca cgtgtttacg aaacgtggta gttgtacggc
    2051  tcgttttcct ttaacggcct cgaggtatga ggctaagtac gatgaataca
    2101  tgaaagacta tgatttgtcg tgggttaaga aggatcgcca tcttgacgtt
    2151  gaggtgatac gccgtaggag aagcggtgtt agtcgtcgtt cggctggccc
    2201  tccgagtgtg ggcacacgcg ttagttctga ccaacagtca gaaccaaccg
    2251  aggctgttcc tacgctcgtt gaagattatt cgccgtgtcg cgacgccttg
    2301  tcgtcgcaac ctggtgttgg gtcggcttgg tttaaggtaa actccccaaa
    2351  tcggtgtgct cgcaccgttc gtgaacggca ttctaccaac aaagggaaga
    2401  ttggggactt tgatttcccg aggggcaccg tgtacaacgc acatgtcgat
    2451  gagagtgctt ataaacgggt gttgaaattg cgggatactt cggcgtcctc
    2501  ttttcttcgc atagttttgg ctcgtctgtc gagttacagg cctcttagcg
    2551  atgagttttt caacaagtgt gtcacatctc ggtttgtggt gtgtgttgaa
    2601  gcagtggagt cgggtcttgt tacagtgcat tttcgctccg atgtttttcg
    2651  tgcgtcattc ccgtttggag tgcatttata tactcgtcac gcgtttgaca
    2701  tttacagtgg taaactactg gcgttagaca cctacggttt ttctgaagat
    2751  ctgagagatg gctattgcta tattcgtcac atcgccgaag tttgcttgag
    2801  catggggagg attttcttta ggagggacgt tcacttagga gcgtatcctt
    2851  atgttttcga ggtgcagcac cgtctcgaga gattatacgg caagctagca
    2901  ctgaagtatg gtgttagagg ttattactcg gcgtcgcgtc tctaccactg
    2951  tagctacagt gattcaccga ggcctatgaa attactcaat aagtatcata
    3001  agatgggcgg tgaagacgga ccgctgttga ttacggatac ggacagactg
    3051  cgagccgtgg gtagcgccta tgaaaaggtg aaggggcgtt tgcctgattc
    3101  gctgcttgtt cgatcggtag aaaaggattt gatagagttc aaccaaactc
    3151  ttgtcgatgc gcagcgagct agaccgggcg ttgttgttcc ttttcaaatg
    3201  agtgagaacc aacaggtgat gctcactagg gcttaccccg agttcaacat
    3251  aaactttact cattccgtac actccgatca cccagtggct gcgggttcta
    3301  gagcgttgga aaacgacctc gttcgtaaat acgccggtcg tgattactcg
    3351  gatgtggggg gttgcccgtt atttcacttg cgtgcgggtc attctggtgt
    3401  tcacgtttgc agaccagtgt acgatattga ggacgctcac cgtagggtga
    3451  ttcgccacca ccagctccgt agagttgagt tggaccatac tgacggttcg
    3501  aaacaggttg gtgcggttaa cacaaactcc gtatgtggta acgttttagg
    3551  ggaatgtttt catgcgtctg atgcgattgt catggtgcaa gtttacgatg
    3601  taccgctacg tgaactatgc agagctatga taaacaagaa agcctcggta
    3651  tgttacatga ccgtggttac gcctggcgag ttgttggatg ctcgcgagtc
    3701  cttcttcatt aaggagttag actgttcagt ggagttggac accgtcgccg
    3751  ataaggtcgt ttattgtttc agcaattcag cgtatacaca cacctactct
    3801  acgatacgcg agtacatgtg tactccttgc gtcgtagttg acgggttttt
    3851  gttcacagtg gagatggttt cgttgaggtg tagcgtgaat tattattgca
    3901  tcactaaatc gcgagtttgt ccgagaatta gcgagactaa acggctgcgc
    3951  tatcgtcggt gtgatagcga cttgatcagg atcaagattc ctcggtactc
    4001  tagtaagact cgtagtcgtt taccagggtg ttattatttg tatttagacg
    4051  ctaagttcgt gagtcgtgtg tacgaatacg tggttaataa ttgtgttgtg
    4101  gtgaacgcta agacttttga atggacttgg aaccacatca agtcctgtaa
    4151  gtcgagagtg gtcatcagtg ggaagatcat ccatagggac gttcctattg
    4201  cgttggagta tttggatggg ttttccgcag ttatgttgtc cgcgggcgtg
    4251  aaaggtaggc agaacgcaga agcgttttct aggcgtctag cggccttttc
    4301  aggcgacact tctcttttcg aattggtgag gttcgccatt tcagagaagt
    4351  gtcgcgattt atttgtgggc attcaggagg ccgtagagag atacgtgaaa
    4401  tcgtacctca gaaactcgtt taatatgagt ttcgtggact tgtcagatcc
    4451  gttgcttacc attagtgagt attcggagtt agatgttcct attgacttac
    4501  cgggtttcgg tagtatgacg gaaggtgatg aagctaaact tatagaagac
    4551  ggggtaaagt cggctttact gcggaaggcg gttcaagatg aagcacgatt
    4601  gattatcggg caaggaggta cgtccgaaat cgtcccttgt ggtgacgatg
    4651  aggaatcagg cggcgataat tcagaccggt cgcacaaggc cgacagcgat
    4701  tctacctcta gcaccagttc cggaggcttg cgagctggag ccgctccttc
    4751  gttgttcaga tgtttgttaa agaagttagg cgggggattc tgtctagcca
    4801  gaaaaatact ggacttgttg tgcgagaagg tgataaggtc cttttcgcag
    4851  ctaaagtgcg gcacctttcg gttaacttcg ttccttaaca cgttgcgcgc
    4901  taagttttct tgccatttct ttgacgattc aattttcgtc actgtctggg
    4951  aaattatctt aaatttgttc agaattgtta atggggtgac taagacgaag
    5001  ctggggtgtc ttcgtaacgt gtttcggctg atacctaggt tgtattctgg
    5051  ttgtaaagac tttgtgaaga ctgttgggga tatgtataaa gacatcgcgt
    5101  tattttccgc ggagttcttt agtaaaagct atactaaact gtgtcggttt
    5151  agtttggaag tattcgatgt cggactcatt gagatttcag cgcgtaacat
    5201  gggactagag acttgtgttt ccatggcttc agctattttt gacgtcgtac
    5251  ttacctatcc tctgggaagt attagctttc ccgtcgtatg cgcgagagtt
    5301  tttggcgccc tcgctatgga agtgggatca aactattgtt ttaagaaaac
    5351  tttcggcaaa cctgaaattt taggagagga cgcttttcgt agaacggtaa
    5401  gtatggtgtt gagcgctaag gctttcgaca aactgtcgat cgacggtaag
    5451  ggtttagtta ggtgctccgg tgttattcct ggagttttga ggatagtgtt
    5501  ttcgtctctg ttttccgatg ccgacgcgtg ggtgggttat agcaaacacg
    5551  aagtttcctc acttcccata atcacgtata gcgcgaaaaa gttatctttc
    5601  gcgttggagc agactaagga agcgtgcatc gcctttatag tcgattcgtc
    5651  taagaggatc ttagcgtctt tgacctcgga gattcacgag tctttccaaa
    5701  attcggaact aactaatggt gctaagtcct tgtatggaca tgtgagttct
    5751  gtactctcag tgtctaatgg tgtggttagc aaggcaggaa acgccgttgc
    5801  agcagttaaa gcggcgggga gtggtcttag taaacgtgtg aggcgcattc
    5851  gtccttcttt tcgcctagct cggtgcgtta atgaacagac cagcgaatac
    5901  tattctgcta gtgacgaatc tgagttggac gagtcgttgc ttagtgacac
    5951  gcccggtctt cgtggtaacg ggaagtgtaa cgatttgttt cgtgtcgttt
    6001  ccggacgtgt tttggtatgt tgtaggcgcg ctgtagaagc cttgaagcgt
    6051  ttagtcctac acgtcggtga ctgcttgtac tcgcgcatta tggactcttt
    6101  tgtgaggtta tttgttgaaa ccaatgttgc agtcgggaag tgtgaatctt
    6151  tcgccgtcga ctgtacccga aaagtttctg atttagtaat cgggtatatt
    6201  acttggcgca atcttcactc cggtgcatat tcgacgactc cagggttatc
    6251  tggtggtagt aggaattctc tttccaggtt cttggatggt ggtctcacgt
    6301  gtgtaattcg aaatattgtt actgcgtggt tgacggtttt tgatgagacc
    6351  ttttatttga gtctagtcca tcggatgagg actgcctcga taaatgtgtt
    6401  gttagaattc ttgaagaacc tcccagtttg tttagtttcg atatacactt
    6451  tcatggagtg tagatctagg attttccctt tgaaggaatt tctttggggt
    6501  ttttgcgttt ttgtttggaa cattgttaag gaactttcca tatgcattta
    6551  cggaagtctc cccgtttgcg ttacgaggtt gtgtaatagg gcgttccgtc
    6601  gcagttccaa cgaaggtgac gtgcgtacgc ttcaagtgat caccgaagct
    6651  gaaaaccgaa tcgagttttt gcgagaagtt ctcgccgaaa tggcacggta
    6701  tcgtgcttct ctcgagatac ccgtaccagg gtcgcctgat agtcctttgt
    6751  ttccaccaac atacggtgag attgaggagt taggtaacga ttcctctgac
    6801  agtgcccgat tgataggtgt ggacaatggt tcaggttcag tgcccactga
    6851  aggcgaagcg gaactagatt cggatggtga tagcgatgac tcaatacctt
    6901  tggatcgcga ctttgagcaa atcggaggtc ttggcggaag cggtaacgtt
    6951  gacgtctttc gtttagggct gaagttcgtg tggagaatgt tgcgtaattt
    7001  gtttaactta agagccgtta aactctccta tgggttagct cttcagtgta
    7051  tatttaacgg tggttcaatg ggccagttta cgtcgcgact gttattcagt
    7101  ttcggcaact gcttaccgtt tgagctcttt agacacgttt gtagtgtgag
    7151  gtggctgtca aagagcttag cactacgtat tcgtaacgct agtatttgtg
    7201  acgaagaaac ggtcgaacat ttcttcagtt tttcgcgatt tttgtatgat
    7251  tcgcgttact tatcggacgt gttttcggtg ttggagaggg tcgattttta
    7301  cttaagttat ctattctcgt tgccgaagag gtgtcttacg cgtaaccgta
    7351  gtgtccgagt ttgcgctaga gctccagttc gtgtgattag gaacgtggga
    7401  cttgtagaag acggcaagaa gtctttaacc gaagtgttga actctttgga
    7451  ctcattgaaa gtgtccgacc gtaaagggaa gtcagcactt attgaaagtg
    7501  atggttccga ctccgagagc ggtcattcgt tcggttccat ttcattcgga
    7551  tcggttaatg aggaagtttt agaagcagtg aacggtggtg ttgtatccga
    7601  aaaagctcca ctgatgaagc atgcggctgc actaagcagg ttggagccgg
    7651  atcttagtgg taataaggat cttcctattg ttaggagaag ttttacccgc
    7701  ggtgaatctt caggtacgaa accgccagga agcttgtgcg tgtacttaac
    7751  gacgttgaat tcttcattcg gttcggtgcc tgacctgtat cccgtcgcac
    7801  gtgacataac gtacaagaag atgacaaacg ccatgcgcga gttttattac
    7851  tcgcaaaagg taacgttgta cgaacttcat ggaaaattga gctcgtactg
    7901  ggatgaatta aagacggtag gttttgatag gaagttggcg aagatggatt
    7951  tagacgatga cgttagtgtc gtcgatttta acttgaaggt aatagtgggg
    8001  aggcacggta cccgtccttt cagaaatact gtgaactctc acgagttcat
    8051  gttttgtgat gacggattgg tgctttgccc gggaccgaaa aaacgtgact
    8101  ttgctctgat ctctagtcaa acgcaattcg ttgctgcgaa ctcattcctg
    8151  cgtgccgtgg acggtaaaga tttgacgttc actaattcgg agcatagtct
    8201  catagtttat gaggctcctc ccggtggtgg aaagacgcat tctttggtaa
    8251  cgtatttcac cgattattgt accaaagtgt cttgcttggt agtgaccgct
    8301  aacaaaaatt cgcaagcgga gatttctcaa cgaatctcca aagaactgat
    8351  ggataggaag atggttgcga aacacgtcat taaaactgct agtagggtgt
    8401  ttacagtgga ctcctatctg atgaatcata ttcatctcaa gactgaattg
    8451  ttatttgttg acgagtgctt tatggttcat gccggggcga tcggagccat
    8501  tgtagaattt acttcttgta aggcagtggt tttcttcggt gacagtaggc
    8551  aaattcatta tatccaccga aatgacttcg gtgtgtcgtt gttacacgat
    8601  atagacgcgt ttatacaacc ggagcaccgc gtttatggtg aagtgtcata
    8651  cagatgccct tgggatattt gtgagtggtt gtccaagttt tatccaagac
    8701  acgtagctac cgctaatatc gcaagcgttg gaaagtcaag cgtgtctata
    8751  gagataataa acggatacga cgacgttcct tatgaaagtg acgccaagta
    8801  tgtcgtttat acacaggcag aaaagaatga attacagaaa catcttggcc
    8851  gtttgacagt gggccgtacc aaaacagtac ccatcgttaa tacggttcat
    8901  gaagttcaag gggagacata caaaagggtt cgtttagtgc ggtgtaagta
    8951  ccaagaagac accccttttt gttcggacaa ccacgttgtt gtggcgttga
    9001  ctagacacgt tgactctcta gtttattcag tgttgaacag cagaagatac
    9051  gacaagactg cttccagcat agacgaggcg agagagattt ttgataaatt
    9101  tcgatcggcg aatcactccc acggttcgtc gtcattggag tggtacctcg
    9151  agaagtaccc taatgagtac aagggtagta aagcgtcttc ggttccgtta
    9201  agctgtatta acgagtttct taacgaagtc gtcgttggct cctcggtggt
    9251  gcaattagga gatacttctg aggaattaag ctctcaaccc tttgagtctg
    9301  gttgtgacaa cgtcactatt agggacactg cccctccaga ttctggtaac
    9351  ttacacgaac cggctcgtgt tcggcgtggt aaggtcacag gcaattccgc
    9401  caagaaaagc gtctctacaa gaaaatcttc tgtcatacga aagtcgtaat
    9451  tacaacttta ttaagaccga acggtacgtg gggcctgaga actttggtag
    9501  agcgatggca gcggctgtac tcgacagatg ttttaagatg gaagaagtgg
    9551  cgaagataag gagtgacata atcgctctga cagaagctaa tattgctaaa
    9601  tggctcgaca agcgcactcc atgtcaagtg aagtcagtgc aagcggagct
    9651  taagttaccg tttgccgcgg aagagcaaat tactaattat aagttaatgg
    9701  tgaaacgtga tgctaaggta aaacttgacg actcttgctt gtctaaacat
    9751  ccagccgcac agaacattat gttccataag aagtttatta acgctatata
    9801  ctccccgtgc tttgacgaat tcaagaacag ggtgctgtcg tcgttgaaca
    9851  gaaatatagt gttctttacg gagatgacga acgctgggtt ggcggaagtt
    9901  atcaggagga ttataggtga tgacgatgat ctatttgtcg gggaggtaga
    9951  tttcagcaag tttgataaat cgcaagattt gttcatcaaa gagtacgaac
   10001  gctctttgta ttctgaattt ggtttcgatg acgaacttct tgacctgtgg
   10051  atggaaggcg agtatcgcgc tagggctacc acgttggatg gccaattaag
   10101  tttttcggtt gacggtcaac gtcggtcggg aggttcgaat acgtggattg
   10151  ggaactcctt ggttaccttg ggtattcttt ctttatacta cgatgtttcg
   10201  aagttcgaat tgcttctcat ctctggcgac gactctttga tctactctag
   10251  agcaccgatt agcaacttct cttcggaaat ttgtttggag acaggttttg
   10301  aaactaaatt tatgtctcct agtgtaccat acttttgttc aaagttcgtg
   10351  gttcaaactg gaaacaaaac gtgttttata ccggatcctt acaagctact
   10401  ggtcaagctg ggggctcctc agtacaaatt gaccgacgac gaactttttg
   10451  agctgttcac ttcttttaaa gatatcactc aagattttgg tgatcaggtg
   10501  gtcctagaga aactgaagtt cttagtggag gctaagtacg ggtttactag
   10551  cggaactact atgcccgctc tatgcgctat acattgcgtg cggtctaatt
   10601  atttgtcttt tgaaaggtta tttcccttta ttagaggttg gtatgttgta
   10651  gacgctttga agcttagaca actgaggaag ttcgctaatt tgatctgtga
   10701  acgtgtggtt tacgacaatc gcgtgggtta tttttcgtac tttgacaatc
   10751  cgtttactaa acccgatgct agcgatggtc aagcggacga cttagcgaca
   10801  ggctgatagt ttgttcagtt ctcgctgaga gctaacacgg gtagttgagt
   10851  cgagatgttt gccttcgcga gcgaaaacca agatatatta gaagaaaaga
   10901  tttttcgccg tagaacctgc catcgtaagt atttgggtga cgtggttggg
   10951  gattttacca ttgatgttgg ttataatgct gccgatcgtg atcctacggt
   11001  actggctgat tatttctcgt tgtatttctt tttgcttaac aatgataaca
   11051  tcgggcctct agcagcttcg attgtagtga gcccgccagt aaacgggact
   11101  cataaaattc gggcgcacgt cgataatcaa ccgaatcgtg aaggaaacgt
   11151  tacttacgtt aagaccgtcg ataagagtcg ttttgtgatt cgcataaaag
   11201  cgatgcccgc ttctacgagg ggctactact cctttcggac gtttgttagt
   11251  ggtgacatcg ctagcgaacg tagcgagttt atgtgcagtt ttgttggtag
   11301  taggtatctt tgttgttgca cacaaacgat atccgaaaat ttgagtaatg
   11351  tttgttcgtc ttctttcttc tttagagccg tttcggaaac cgctactaat
   11401  gagttctctg ttgtgactga tgatgtagaa gacgttaagt acgtaagaaa
   11451  acgggtcgag ggtttttcac attgcgctga cccacatcct cctaggtgtt
   11501  atcgtaacaa taatttaggt gattcttcag gggttcaaag tcgcacgatt
   11551  gaagaggagg gttataggac ggacaccgta agtaacgtca cggttaccat
   11601  cccgaatact ccgctcgtta atgccgtctc tccgtatgtc gcggagttca
   11651  acgagaacac gcgttcgcgt gtctcgttaa tacggcgagt ctgctgttac
   11701  gccgtttgtg ttttagtagt ttctcttctc ataatgagcg gtttgatagc
   11751  catcatattt atatgagatt ggtgtagtaa cttatggggc gtggttagct
   11801  aaaactcacc gtttgactct gtttaaacgg ggttcaatgg actgtgtgat
   11851  tcaaggattt ttgacttttc tagttggtat agctgtgttt tcggcttttg
   11901  ccggactaat tatcattgtt ataacgattt atcggtgtac gactaagccc
   11951  gttagaaacg cctctcctta cggcactcac gccactatct aagcggtatg
   12001  gtgcttctga gtctagactt tggtaccacg ttttcgacgg tggctatggc
   12051  tacatcttct gagttagtga tacttaaaca atccaattcg tcgtacatac
   12101  ccacgtgttt gtttctgcat gcagatccta acagcgtgtc ttatggttac
   12151  gatgcggagt acttagcgac ttcaggggaa cctggctcgt tttacaaaga
   12201  tttgaaacgg tgggtcggtt gtactgagaa gaactaccaa agttatttgc
   12251  acaagttatc accttcctat aaggtgatag taaaagagtt cggaattaag
   12301  agtatgccgg ttccgtattt gtcacctctg aataatgatc ttgggctcag
   12351  tgtcgctttg ccttcgttga tcgctttata taccaaatcg attttatcgg
   12401  atgcggagag ggtgttcaac gtgagttgca ccggagttgt atgttcggta
   12451  cctgctggtt ataacacgtt gcaacgagct tttacacaac aaagtgtgtc
   12501  cttgtcgggt tatacttgcg tgtatatcat taatgaacct tccgctgccg
   12551  cttactccac tttacctaag ttgagttcgg cggataaata cttggccgtt
   12601  tacgtcttcg gcggtgggac ctttgtcgtt tctatagtta gtgttaggtt
   12651  acccacgttc gccgttagaa gttcgggtgg tgatatgaac ttaggcggca
   12701  gagacatcga tagaaagtta tctgataaaa tatatgagtt ggctgatttt
   12751  ttaccgcaaa aagaactgaa cgtttccagt ttaaaggaag ctttatctct
   12801  tcaaaccgat ccagtcaagt atactgtaac tcattacggg atgagtgaaa
   12851  ccgtatcaat cgatcaaaca acgttgaggg agatagcttc ggtatttata
   12901  acacgaacgg tagacatact tacacaagtt aaagctaagt ctagtatgcc
   12951  cgagtcgcaa agtttgaagc tagtggtagt cggtggaagc tcgtacttac
   13001  cagggttgtt ggatactttg gaaactgtac cttttgtgtc tgggatagta
   13051  ccggtggaag acgcgagaac cgccgttgct agggggtgcg ctttatatag
   13101  cgagtgtctg gatggtaggt ctaaggcctt actaatagat tgcattacgc
   13151  atcatttgtc ggttacgaca tttagtgcag actcggttgt tgttgctgcg
   13201  gccggaagtc caattccttt tgaaggagaa cgaaaactca cgttgcgtaa
   13251  gtgtgttagt acatcgaatt atcaagcaag gatgttcgaa ggagattacg
   13301  aaaaagtttt ccgaaacgaa cgtatatacg cagcttcagt gtcattgttt
   13351  actttaggag ttaactggcg cgtgcctaac gacgttgaga tgactctcgt
   13401  gaccaaagtg gactcaatgg gtaaagtgga attctacctt aaaggtccat
   13451  ctggtgaact agttaacgtg caaggtactt cacattatga ttatgttggt
   13501  atgcctcatc ccactagaaa gttgttgagg cttagcgatt acaatgtaaa
   13551  ctccgccgct ttagttttag ctttgacatt gactcgcgaa aaacgagaaa
   13601  aatttctttt gcgaacttta ttcgatactt tactagcgga cctgcgaaag
   13651  accgcaagtt taagcgaata ttctaagaaa tatccgatta ctcgaaacga
   13701  tatcgatgtg ctttcatcac gtatggggat cgttgtttcg aaagttttac
   13751  ggggaagcga tttggaaaga gtacctctct gaatcaactc gaaatttcga
   13801  tgagagaaac atatcgttgg accacacttt aagctcaggt gtggtcgtcc
   13851  gtaggcaaaa tcttttgaac gcacctcaag gaacttttga gaatgagtta
   13901  gcgctattat acaattcagt agtaattaac gattttgttg aattgactgg
   13951  tatgccgttg aagtctttga tgacgggtgt tgaggaccgt aaaatacctg
   14001  acgagttaat atccgttgac ccgcatgaag ttggatgtag attcacgttg
   14051  aatgatgtag aatcatatct aataagcagg ggtgaggatt ccgctgatgt
   14101  aacggcggtt gagcactcgt ggtgtttgag caattcttgt ggcagattgt
   14151  taagttcgac tgaaatagat acttacaaaa ctatggtgtt tactaagact
   14201  tttgatagtg gtgtatttgg ggtgaccact aaattagaga cgtatctatc
   14251  atactgcata tcgttgtaca agaaacattg tatgaaagac gatgattact
   14301  ttaaccttat attacctatg tttaattgtt tgatgaaggt gctggcgtcg
   14351  cttggtttgt tttacgaaaa atatactgac aatccgctgc tgaccggcat
   14401  gcttatagag ttttgcctag aaaataaggt gtattactct acttttaaag
   14451  taaatttgga caacgttagg ctgtttaagt ctaaagtgtt gcctgtggtg
   14501  ttaacggtct ggaatatatc tgagcctgat gacccggcgg acgagaggac
   14551  actagttcct ttcgatccta cggatttcgt gcttgatata cccaaactga
   14601  atatacacga cacgatggtg gtggtgggta atcaaatcag acacttagag
   14651  cacgtggttg agagcgatgc tttagacgac ttgtctcaac acgttgactt
   14701  gaatttagca gcggacaacc ccgatctacg tgttgatttg cgttgggcag
   14751  ggatgtttgt gtattacggc gtataccggt gtgctgtgga tagagtggta
   14801  gaacgaccgg cattatttaa tttaccgcgg aagttgttaa gtcaggacga
   14851  cggtgagtca tgcttgttac gtatgagttc cgttgaaacc ttatttaatc
   14901  tggtgcagaa ggtaaataag gacataaaca tcaggcgtca attcatggga
   14951  cgtcatagta aagtggcttt gcggttgtat cgcaatttag gtttgaagtt
   15001  tcctccaatt tcctcagtta ggttaccagc tcatcacggc tacttgtacg
   15051  tcgactttta caaaagaata cctgataatg ctgttgatgc cgacgaactg
   15101  gaaagtttac gtcaattacg ttcatccgtg gacgttatgt gtaaggacag
   15151  agtgtcagtc acgcctccac cgtttaatcg acatagaaga ggttcttcta
   15201  gaatacttag aggtcgaggc gcacgcggtg cgagctcgcg ttatatgagc
   15251  agagacgtgg caacatccgg ttttaattta ccctttcatc atggcgggtt
   15301  acacgatgct tcctaaaact gatgacaaag aaatggatcc ggtgagtgcc
   15351  gctgtgcccg gtaaataccc ggacgttatc gaaaagtttg tgaccaatag
   15401  gtcggtagat gcgttaatag aaggtgttat tagcaagttg gatactaatt
   15451  caatatacga agattccact gaaaaatttg ctggtgagca attgaagtac
   15501  gtcatggtta ctatggacac tttcttacta gaaaattaca aaacgaaagc
   15551  ggaagatctg ctggttcact tggctatgat tcaaaagagg ttgtgcacta
   15601  tatctacgag tactaaaacc aaatatcgtg ataaaggttg tatcagttac
   15651  gtgcaagggg gtttacgata taagttaatg gataaagtag tttttccttt
   15701  tattatatct aagtttactg acagggagac tccaaatgct ctacgtaagt
   15751  atgcttgtac ttttgaggag ttgcacttgt gcacggctag actgagaccc
   15801  gacttatacg aaaacaaaag gacgaccaaa gctgggactc cgcatttaaa
   15851  agggtactta tcagctgact ttcttacggg ttccctccca ggatactccg
   15901  aacatgaacg aggtatcatc cttcgagcgt ctgagtctat gttagctaga
   15951  cgtcaaggtt acgaggaggc aaccgaactt cttaacttac gcgatttggg
   16001  aaagtatttg tagtttgttt gcggacggtg gtattacgcc atcccatgag
   16051  cactgcttta agggtcgtta attgacgact cttgatattt actaagtttg
   16101  agttatggac gacgagacaa agaaattgaa gaacaaaaac aaggaaacga
   16151  aggaaggcga cgatgttgtt gcagcggagt cttctttcgg ttccttaaac
   16201  ttacacatcg atccgactct gatagcgatg aacgatgtgc gtcagttagg
   16251  tacccaacag aacgccgctt tgaacagaga tttgttcctt actttgaaag
   16301  ggaaatatcc taatttgtct gataaagata aggactttca catagctatg
   16351  atgttgtatc gtttggcggt taagagttca tcattgcaaa gtgatgacga
   16401  caccacgggc ataacgtaca ctcgagaggg cgtcgaagtg gatttgtctg
   16451  acaaactttg gactgacgtc gtgtttaatt ctaagggtat cggtaaccgt
   16501  actaacgccc ttcgagtctg gggtagaagt aacgatgccc tttatttagc
   16551  gttttgtaga cagaatcgca atttgagtta tggcggacgt ccgctagatg
   16601  cagggattcc ggccgggtat cattacctgt gtgcggattt cttgaccgga
   16651  gctggcttga ctgatttgga atgtgctgtg tacatacaag ctaaagaaca
   16701  attgttgaag aagcgagggg ctgatgaagt tgtagttacc aatgtcaggc
   16751  agcttgggaa atttaacaca cgttgatcta ttgcgttctg attctcgatt
   16801  tctatcggga tggtggagtt tcatcgtgaa cgtgggtgag ataatcgttc
   16851  ggtttgcgtt acatgttcct agtgaggata tgctgaatag cttttcagct
   16901  atatcgaatt gtacgatcat agcagacggt agtgctttac taaaagacaa
   16951  cactgtggtt gaccgtttag agagcatgaa tcctttggct tatttgttaa
   17001  aattagcgaa aacgactact actatttgtt ttactatgtc taataaggtt
   17051  ctttttggta ctactaaatc tgaaccgctt agttgtttag ctatcacgtc
   17101  ggatcgagtt ttattcaaag ttatcatggg tattaacgtt gatgattctc
   17151  gatgtggctg cagtatttgg ttttacaaca atgggacgtt tcaaaacggg
   17201  ttgacccgtt gtaacaatct cgtcgctttg tttagcgcga cttagacacg
   17251  aagtgaccgt tcgggtttaa ttgctgcaat gggtattcga cgcgtgtggt
   17301  taaaggttat ggctgtaatt acggtattgt ggtatggtaa ggaaccttcc
   17351  attagcgaag gttacaatgc tcttatgaat gatgacttta agttcatcga
   17401  tgcgcacttt tcaaatgttt cttatgctaa gaaatgttac gagttggcta
   17451  acttcgactt agactttcta cgcatcgtca tcattccctt gagcggtggt
   17501  gcggtgaatg aatcgcgtgc tgatcgcgct aacgtttcag agattgtcga
   17551  atcgcatatg agcgaccgag atagaatgaa agtcttgttg cgtaataagc
   17601  ggatccagat tccttcgctc ttaccttgcg ataactagag tctactcagt
   17651  agtacgtcta ctagtataac gtattaaaca ctttagtgag gagttttgtt
   17701  taaactaaac aatatgcgag cttactttag tgttaacgat tacataagcc
   17751  ttttggctaa ggtcggcgca gttgtggaac gtttgtgcga tcctagcgta
   17801  actctcacgg aagtgatgga cgaaattaat gattttaact cgtttctcgc
   17851  tttggtacac tctatgaagt cggacatgaa cggcgatcat caggatggtc
   17901  accatgagat gggtgaacac aagtctcgat tgttgtgcaa tatagaggcg
   17951  aaactgcgaa tacttctcga catcataaga cgtcggttta ctcgcgacaa
   18001  gctgctctgt accagcgcaa cagatgtcat gggcttcttt gttatgaggt
   18051  acatgagttc tagtcacacc agtttcgagt ccgtaatgcg aacggagctg
   18101  aaattagtgg ttaaagcggt actgtcggat ttatcccgcg cgcataaact
   18151  agattttagc gagcgagcct ttgcggctta cggtatcctt ttacaaaagg
   18201  gtactgtatc gaccgtttgc ggtcagtttg acattaattt agtttctcct
   18251  tcatgcgtgt aggttaatac gcttctcaga acgtgtggtt gtattaacta
   18301  actttaattc gaacaagttt attgttaaaa gtctgtgagt tacgatggat
   18351  gatactagcg gacaaacttt tatttctgtg aacctttctg acgaaagcaa
   18401  cacagctagt actgaaacca aagccgtaag ttcggaagtg gatcgcttgg
   18451  aatttttacg gaaaatgaat cccttcatta tcgacgcttt gatacggaaa
   18501  aacagttatc aaggcgctcg ctttcgcgcg agaataatag gagtgtgcgt
   18551  ggattgtggt agaaaacacg ataaggcatc gaggactgaa cgtaagtgta
   18601  aggtcaacaa tacgcagtct cagaacgagg tggcgcatat gttgatgcac
   18651  gatcccgtaa aatatttaaa taaaagagaa gctagagcct tttctaacgc
   18701  agagatgttt gcgatcgatt tggttatgca caccaaagaa aggcaattag
   18751  cggttgattt ggccgctgaa agggagaaga cgagattggc tcgtagacac
   18801  ccgatgcgtt ctccggaaga gactccggaa cattataaat tcggtatgac
   18851  tgctaaggca atgttaccga acatcaacgc tgtagacgtt ggtgataacg
   18901  aagacacctc gtcggagtac ccagtaagtc tgagtgtttc cggcggagtt
   18951  ctccgtgaac accacttcat ctgattgaag tggacggaat aagttcctcg
   19001  cggaactata tgtcgggttg gtaaaaaccc ttatgatggt gatttatcac
   19051  tagacaataa ccggatgggt aaagtcttta aaatgatcga ggggaaaatt
   19101  aaccatatcc tctcgttggt ctaagctccc acagagtggt agtggtctca
   19151  agtgaggctt aacgtatgcg tgaaccaaag aagttctcct tagagtgtgt
   19201  gttgtttacc caacacactg tccctatggg gggccaacat aggtcca