Sequence of DPV Black raspberry virus F

Black raspberry virus F, complete genome.

ACC No: EU082131

Dated: 2008-02-21 | Length: 5077 | CRC: 1986597649

                
ID   EU082131; SV 1; linear; genomic RNA; STD; VRL; 5077 BP.
XX
AC   EU082131;
XX
DT   28-AUG-2007 (Rel. 93, Created)
DT   21-FEB-2008 (Rel. 94, Last updated, Version 2)
XX
DE   Black raspberry virus F, complete genome.
XX
KW   .
XX
OS   Black raspberry virus F
OC   Viruses; unclassified viruses.
XX
RN   [1]
RP   1-5077
RA   Tzanetakis I.E., Halgren A., Martin R.R.;
RT   "Black raspberry fungal virus";
RL   Unpublished.
XX
RN   [2]
RP   1-5077
RA   Tzanetakis I.E., Halgren A.;
RT   ;
RL   Submitted (05-AUG-2007) to the EMBL/GenBank/DDBJ databases.
RL   Botany and Plant Pathology, Oregon State University and USDA-ARS, 3420
RL   Orchard Ave, Corvallis, OR 97330, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5077
FT                   /organism="Black raspberry virus F"
FT                   /specific_host="black raspberry NCRG CRUB 9013"
FT                   /isolate="CRUB 9013"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /db_xref="taxon:463392"
FT   CDS             109. .2418
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:A7XMH5"
FT                   /db_xref="UniProtKB/TrEMBL:A7XMH5"
FT                   /protein_id="ABU55398.1"
FT                   /translation="MDAFLKKFFEGFEAPGAEFSFNASPARIYTFFQSLLRVDCDGVIQ
FT                   NRPFYVNQPMTPLGKMTARFGSTVSTLDGISKPYLTPEGVINLNAIGDVLKSTGGMTSN
FT                   AWSLHMGVVKGWNWADNHVPLLVNMLRYTLIKHIQTVAGTLDATLGTYDDGHVTINSDG
FT                   CFTEAYPEEAAWDGWPFAVPEGQAAIEAWTQFTRFETAEPQANDVCLDLRNLTPQESAF
FT                   VLLMCTQWQRKSRLRLDFALPELAHAISYRASAEPAGFAGWLSGTYVAAQGPPAAPGPE
FT                   LAWSALKKYVNQNRLYDHFSTALYLVACSMYQFAPVTAEAHSWLDVDWDLSLPLFHSVR
FT                   GRYTFLNEDEAAFISHRALNEWSYYSVNINRINLLALTFSQAYHTGFAVRNVRKSITGK
FT                   LDDIYTTEGELLAPISMIPSAASEAVRAPVPLSGMSGVYMYTQYNLLDYDPNRTITLEN
FT                   DYTGEDDGYDLIEPEVTTRTEVTVRAGVDLNALLLGGPPAAGTRGGNNAAARGRGLGRG
FT                   GRNGGRGNGSTSAEAEDGDENLTIDNFDPNDYFEVVEIEEPAGPTTLRVPWMTFPGYPT
FT                   MLVPIDPFPDVNIFTLKGKIDGTTGDCTRWGFKTTAMRAWYVANLYRLCGYDLDFSSAQ
FT                   NLVGGEKFYAPNNVGFVWPILYEPNHQHDEIVINYQQQRMHHFITLPQIINNFFKNKTI
FT                   EFSHRIIRRGTTTSAYGNWLDVVESSGVVQMFANMTVAYNTSAAVSRLRAYITRSEEGF
FT                   RFVDNVQGGAIPPPTE"
FT   CDS             2565. .5009
FT                   /codon_start=1
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="RdRp"
FT                   /db_xref="GOA:A7XMH8"
FT                   /db_xref="UniProtKB/TrEMBL:A7XMH8"
FT                   /protein_id="ABU55399.1"
FT                   /translation="MNIPVWVTIRGECLTAVDREKAKYVLAHVSYSNTQDSPGFGMFRV
FT                   GKECVKGFMARCEDIWVYYVKTSTPAISLPPVVKRTMSAMYSGVEDYDFSDFRGHRFLR
FT                   RKFGVVREEIIHAKNIKPPQKGEFEKSKITGEHHTHYTPDEVWEIAVQTNTMRRALLLV
FT                   VDKLREISGVTEAIVSTFMAYIMFAKPQVAYLLATSANIWRAKDVNTLAEKLKEISTPL
FT                   KSMHRHDVLDMTQLFELQVLVNRGIGKVDWVNERKHRQKPDTVKVGFTDVYCEARRLFE
FT                   LGVQRGFKYPTMDFDKYLKSRWEWVPTGSVHSQYEGDQEYIAKDYRHRSKFVTLNRLSC
FT                   DQIREMFNRKPEIQAWASVKYEWAKQRAIYGVDLTSSVITNYAMFRCEDVLRHHFPIGS
FT                   EADAQRVHKRLTYMLKDTESFCYDFDDFNAQHSIESMEAVLLAYYDQFKDQMTAAQASA
FT                   MEWVCQSVKEMIVNNNEVQPPEKYKLKGTLLSGWRLTTFMNTVLNYIYFRISGALKTPD
FT                   VVDSVHNGDDVLLSINNLKAAVEVDSRMAKIGARAQAAKCNVFSIGEFLRVDHKISREK
FT                   GVGAQYLSRAAATLVHSRIESQAPLRLIEAVKAAYTRASEVAMRSDQSSEISALFFHKA
FT                   AKRLSSIFGVDYEKVRIAANQHVVTGGIRQDFMASVEYLIHEEVEREKLGTDSLHNLGQ
FT                   VDVSDLGEGIKDYGSVLMSQYGKYTTEERIYKSIVSATGRQLSITRSTRLSVVDVRHDT
FT                   KYGYGRALYGYLRNLVNLPYVEKARFVGISPLAMLDAKGMGTLRKYIMGASDVDYTLRV
FT                   LL"
XX
SQ   Sequence 5077 BP; 1516 A; 973 C; 1336 G; 1252 T; 0 other;

eu082131 Length: 5077  21-FEB-2008  Type: N  Check: 6909  ..

       1  gaagttttca aagcaatata taccctcaca gcttttaaaa cttcttttta
      51  ctgctttcga taaagaactc tctcgcctta tctctttcta cttattaatt
     101  tagctatcat ggacgctttt cttaaaaagt tttttgaagg ttttgaggca
     151  cccggagctg agttcagctt caatgcctct cctgcaagga tttacacttt
     201  tttccaatct ttgttaaggg ttgactgtga cggagtcatc cagaacaggc
     251  ccttctatgt caatcaacct atgacccctc tgggcaagat gactgccagg
     301  tttggatcta ccgtctctac tcttgacgga atctctaagc cgtatttaac
     351  tcctgaaggc gtgataaacc tgaacgcaat aggcgatgtt ttgaagtcga
     401  ctggcggaat gacatctaac gcctggtctt tacacatggg agttgtgaaa
     451  gggtggaact gggctgacaa ccatgttccg ctgctggtca acatgctgcg
     501  atatactctt atcaagcaca tccagactgt tgcagggaca cttgatgcta
     551  cgctcgggac gtatgatgac ggtcacgtca cgatcaacag tgatggatgc
     601  tttactgaag cgtatccaga ggaggctgct tgggatggat ggccgtttgc
     651  agtacctgag gggcaagctg cgatagaagc atggactcag tttactcgtt
     701  tcgaaacagc tgagcctcag gcaaatgatg tttgccttga tctacgaaac
     751  ttgacacctc aggagagtgc atttgttttg ctgatgtgca ctcagtggca
     801  gaggaagagc aggctgaggc tcgactttgc cctacccgag ctggcacatg
     851  ccataagcta ccgggcgtct gctgaaccgg ctggatttgc tggttggctg
     901  tctggtactt acgtagccgc tcaggggcca cctgcggcgc cggggcctga
     951  gttagcctgg tctgcgctta aaaaatacgt taatcagaac agattatacg
    1001  atcacttttc aacggcgctg tatcttgtgg catgctctat gtatcaattt
    1051  gcgccggtta ccgccgaggc ccactcgtgg ctagacgttg actgggatct
    1101  atcactacct cttttccact cagtaagagg taggtatact ttcctcaatg
    1151  aagatgaagc tgcgttcata agtcataggg ctctgaacga atggtcatac
    1201  tacagtgtca acattaatag aataaatctg ttggcactca ctttttcgca
    1251  agcatatcac acaggatttg cagtgcggaa cgtgcgcaag tcgataactg
    1301  gaaagctaga tgatatttac acgacagagg gagaacttct ggccccaatc
    1351  agtatgatac catctgcggc ctcagaagct gtacgcgcac ctgtcccgct
    1401  gtcggggatg tctggggtgt acatgtacac tcaatacaat ttgttggact
    1451  acgacccaaa cagaacaata acactagaaa atgactacac tggggaggat
    1501  gatggatatg atctcatcga gccagaggtc actactagga cagaggtgac
    1551  tgtgagggcg ggggttgatt tgaatgctct gctactggga ggaccgccgg
    1601  cggcaggtac gagaggcgga aacaacgcag ccgcccgagg aagagggtta
    1651  ggcagaggcg gcagaaacgg aggccgtggg aatggtagca catcggccga
    1701  agcagaggat ggagatgaga acttgaccat tgataacttt gacccgaatg
    1751  actactttga agtagttgag atagaagaac ctgctggacc gacaacttta
    1801  agggtaccat ggatgacatt tcctggatat ccaacgatgt tggtgcctat
    1851  tgacccgttc ccggatgtga atatattcac attgaaggga aagatagacg
    1901  gtacaacggg tgattgtact aggtggggat ttaagacgac tgccatgcga
    1951  gcgtggtatg ttgcaaactt gtacagatta tgtggatacg acttagattt
    2001  ttcgtctgct cagaatctgg ttgggggaga gaagttttat gcccccaaca
    2051  atgtaggttt tgtctggcct atattgtatg agccaaatca ccaacatgac
    2101  gagatagtaa ttaactacca gcagcagagg atgcatcact tcatcacgct
    2151  gccgcagata ataaataatt tctttaaaaa taagacgatt gagttcagtc
    2201  accgaataat cagaagaggg acaaccacaa gtgcctacgg taactggctg
    2251  gatgtggttg agtcgtctgg cgtcgtacag atgtttgcga acatgacggt
    2301  tgcctacaac acaagcgcgg ctgtctcgcg gctaagagca tacataacca
    2351  gatcggagga gggttttcgg tttgtagaca atgttcaggg tggagcaatc
    2401  cctcctccga cggagtgaca aactgcccaa gatgctggcg agtgttgggc
    2451  aagtggtttg atgaggcgct gaataaatac gagggagaag agatacaaat
    2501  aatcaatgta ggactaaata aagaaaaatc gataaaaatt aaaaagaaag
    2551  agactttgaa taaaatgaat atacctgtgt gggtgacaat aaggggagaa
    2601  tgtttgactg cagttgacag agaaaaagcg aaatatgtat tggctcatgt
    2651  tagttacagc aacacacaag actcaccggg gttcggaatg tttagagtag
    2701  gaaaggagtg cgtaaaagga tttatggcta ggtgcgaaga catatgggtg
    2751  tattatgtaa aaacgagcac cccagcaata tcactgccac ctgtcgtgaa
    2801  gagaacgatg tcggctatgt attcaggggt ggaagattat gatttcagtg
    2851  acttcagggg gcatagattc ttgagaagga agttcggtgt ggttagagag
    2901  gaaataattc acgcgaagaa cataaagccg ccacaaaaag gagagtttga
    2951  gaagtccaag ataactggag agcatcacac gcattacacg cccgatgaag
    3001  tatgggaaat agcagtacag accaacacca tgcggagggc tttattgttg
    3051  gtcgtagata agctgaggga aatatcgggg gtgactgaag caatcgtgtc
    3101  gaccttcatg gcctacatca tgtttgccaa accccaggta gcttaccttc
    3151  tggctacatc tgctaatatc tggcgagcaa aggacgtaaa tacactggcc
    3201  gagaaactaa aggaaatatc gacgcccctc aagagtatgc acagacacga
    3251  cgtgctagac atgacacaac tatttgaatt acaagtattg gtcaacagag
    3301  gaataggtaa agtagactgg gtgaatgagc gtaaacacag gcagaaacca
    3351  gacacagtaa aagtgggttt caccgacgtg tattgcgaag caaggaggct
    3401  gtttgagcta ggtgttcaga gaggattcaa gtatcccaca atggattttg
    3451  ataaatatct aaagtcgcgg tgggagtggg taccgacagg tagtgtacac
    3501  tcacaatatg aaggcgacca agaatatata gcgaaagact accggcacag
    3551  gtctaaattt gtaaccttaa acaggttaag ctgtgatcag ataagggaaa
    3601  tgtttaatag gaagcctgaa atacaagcat gggcgagcgt gaaatatgag
    3651  tgggcgaaac agagggctat atacggagta gatctaacca gttctgtgat
    3701  aactaattat gctatgttta gatgtgagga cgtactcagg catcattttc
    3751  caataggaag tgaggctgac gctcagaggg tacacaagag attgacatat
    3801  atgctgaaag atacggagtc tttttgttat gattttgacg atttcaatgc
    3851  tcagcattcg attgagtcaa tggaggctgt tttactagcg tattatgatc
    3901  agtttaaaga tcaaatgaca gcagctcagg cgtcagctat ggaatgggtg
    3951  tgtcagagcg taaaagagat gatagtaaac aataacgaag tacagccacc
    4001  tgagaagtac aaattgaagg gaacactact ttcgggatgg cgattaacta
    4051  ctttcatgaa cacagtgctg aactatattt attttagaat atctggagct
    4101  ttaaaaacac cagacgtggt tgattcagtg cataacggtg atgacgtact
    4151  attatctata aacaacctaa aggcagcggt tgaagtagat agtagaatgg
    4201  ctaagatagg ggcgagggca caagcagcga agtgcaacgt gttctcaatc
    4251  ggtgagttct tgcgcgtaga ccataagata tctagagaga agggagtcgg
    4301  cgctcaatat ctgagtagag cagctgctac cctggtacat tctagaatag
    4351  agagccaagc gcccctgcga ttaattgagg cggtcaaggc agcatataca
    4401  agggcatctg aggtagctat gcgaagtgat cagtcatctg aaatttcagc
    4451  gctattcttt cataaggccg caaagcgact gtcgagcata tttggtgtgg
    4501  attatgaaaa agtaagaata gcagcaaatc agcatgtcgt gactggcggg
    4551  ataaggcaag acttcatggc ttcagtagag tatttaatac atgaagaagt
    4601  tgaaagagaa aaattaggaa ctgactcctt acacaatctg gggcaagtag
    4651  atgttagtga cctaggagaa ggaattaagg actatgggag tgtattgatg
    4701  tcacaatatg ggaaatacac aaccgaggag agaatataca aaagtatcgt
    4751  gtcagccacg ggtagacagc tgtcaataac gcgcagcacg cggttgtcag
    4801  ttgtcgacgt gagacacgat acgaaatatg gctatggcag ggctttatac
    4851  ggctatctga gaaatctagt taatctacct tatgtagaga aggcaagatt
    4901  tgtggggata tcgccgttgg ctatgctaga tgctaaaggc atgggaacat
    4951  taaggaaata cataatgggc gcaagtgatg tagattatac actgcgcgta
    5001  ttactttaat gttatactac tgttggaata acaacgtaga ccatgccaga
    5051  attaagaggg caggtaactc tttaagc