Sequence of DPV Strawberry mild yellow edge virus
Strawberry mild yellow edge virus isolate sy04 triple gene block protein 3 (TGB3) gene, partial cds; and coat protein (cp) gene, complete cds.
ACC No: EU107086
Dated: 2007-08-29 | Length: 878 | CRC: -1955005570
ID EU107086; SV 1; linear; genomic RNA; STD; VRL; 878 BP. XX AC EU107086; XX DT 29-AUG-2007 (Rel. 93, Created) DT 29-AUG-2007 (Rel. 93, Last updated, Version 1) XX DE Strawberry mild yellow edge virus isolate sy04 triple gene block protein 3 DE (TGB3) gene, partial cds; and coat protein (cp) gene, complete cds. XX KW . XX OS Strawberry mild yellow edge virus OC Viruses; ssRNA positive-strand viruses, no DNA stage; Flexiviridae; OC Potexvirus. XX RN [1] RP 1-878 RA Yang H., Zhang Z.; RT "Sequence diversity of the 3' terminal genome for Strawberry mild yellow RT edge virus"; RL Unpublished. XX RN [2] RP 1-878 RA Yang H., Zhang Z.; RT ; RL Submitted (04-AUG-2007) to the EMBL/GenBank/DDBJ databases. RL College of Horticulture, Shenyang Agricultural University, Shenyang, RL Liaoning 110161, China XX FH Key Location/Qualifiers FH FT source 1. .878 FT /organism="Strawberry mild yellow edge virus" FT /isolate="sy04" FT /mol_type="genomic RNA" FT /country="China" FT /virion FT /db_xref="taxon:12187" FT gene <1. .175 FT /gene="TGB3" FT CDS <1. .175 FT /codon_start=2 FT /gene="TGB3" FT /product="triple gene block protein 3" FT /protein_id="ABU63408.1" FT /translation="TIALVSNSGCYVHFDGRSATTTCPPGPWVESIANGLYTAGLARPH FT PESECERRQSSW" FT gene 45. .773 FT /gene="cp" FT CDS 45. .773 FT /codon_start=1 FT /gene="cp" FT /product="coat protein" FT /protein_id="ABU63409.1" FT /translation="MGDQPRPPAPPAPGSNPLPMGSTPPVLPGRTPNPNVNVANQVGDP FT FRVLTPEELAAPIAAASNKVATREQIIQIVADLNALGFVGDPALGLFDLAFHCYDIGSS FT PSAQPVGASPFGCSRMQVAAVVRNHCTLRQLCMFYAPSVWNKAVKDNRPPGNWANLQFT FT PETKFAAFDFFDGVLNPASQQVALWRQPTPQEIYASATHKDVATYRAASKAHXRIXNST FT LLTKGASRSTPPALMPGPDA" XX SQ Sequence 878 BP; 184 A; 275 C; 202 G; 215 T; 2 other; eu107086 Length: 878 29-AUG-2007 Type: N Check: 342 .. 1 cacaatcgcc ctggtcagta attccggttg ttacgtgcac ttcgatggga 51 gatcagccac gaccacctgc ccccccggcc cctgggtcga atccattgcc 101 aatgggctct acaccgccgg tcttgcccgg ccgcaccccg aatccgaatg 151 tgaacgtcgc caatcaagtt ggtgaccctt tccgggtgct cactcctgag 201 gaacttgctg ctccgatcgc tgctgccagt aataaggtag ccactcgcga 251 gcaaataatc caaattgtcg ctgatctgaa cgccttgggc tttgtcggag 301 atcctgctct gggtctcttc gacttagcct tccactgcta cgacattggt 351 tcctcgccct cggcacaacc tgttggcgct tccccttttg gctgctcgcg 401 catgcaagtt gccgccgtcg tccgaaatca ttgcacgctt cgccagctct 451 gtatgttcta cgccccaagc gtttggaaca aagcagttaa ggacaatcgt 501 cctcctggca attgggccaa tctccagttc accccggaga caaaatttgc 551 agcttttgat ttcttcgacg gcgtgctcaa tccggccagc caacaagtcg 601 ccctgtggcg ccagcccaca ccgcaagaga tttatgcctc agccactcat 651 aaagatgtag ctacttatcg tgcagccagt aaggcgcacg ancgcatttn 701 caattccacg ctcctgacta aaggagctag taggtccacg ccgcctgcgc 751 tcatgccagg ccctgatgct taacatccgt ggattaggct taaaatggga 801 gtttcttctc acttcttcta cccagctcca atgagtgcca tgaagtgaat 851 ttagtactac ttaaccgtac tagtatag