Sequence of DPV Cucumber leaf spot virus

Cucumber leaf spot virus, complete genome.

ACC No: EU127904

Dated: 2007-09-22 | Length: 4431 | CRC: 225830907

                
ID   EU127904; SV 1; linear; genomic RNA; STD; VRL; 4431 BP.
XX
AC   EU127904;
XX
DT   22-SEP-2007 (Rel. 93, Created)
DT   22-SEP-2007 (Rel. 93, Last updated, Version 1)
XX
DE   Cucumber leaf spot virus, complete genome.
XX
KW   .
XX
OS   Cucumber leaf spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Aureusvirus.
XX
RN   [1]
RP   1-4431
RX   DOI; 10.1016/S0168-1702(97)00105-6.
RX   PUBMED; 9453144.
RA   Miller J.S., Damude H., Robbins M.A., Reade R.D., Rochon D.M.;
RT   "Genome structure of cucumber leaf spot virus: sequence analysis suggests
RT   it belongs to a distinct species within the Tombusviridae";
RL   Virus Res. 52(1):51-60(1997).
XX
RN   [2]
RP   1-4431
RA   Miller J.S., Damude H., Robbins M.A., Reade R.D., Rochon D.M.;
RT   ;
RL   Submitted (30-AUG-2007) to the EMBL/GenBank/DDBJ databases.
RL   Agriculture & Agri-Food Canada, 4200 Hwy 97, Summerland, B.C. V0H 1Z0,
RL   Canada
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4431
FT                   /organism="Cucumber leaf spot virus"
FT                   /mol_type="genomic RNA"
FT                   /country="Canada"
FT                   /virion
FT                   /db_xref="taxon:165432"
FT   CDS             132. .2348
FT                   /codon_start=1
FT                   /transl_except=(pos:798. .800,aa:OTHER)
FT                   /product="P84"
FT                   /note="replicase"
FT                   /protein_id="ABV30916.1"
FT                   /translation="MANMVLSCLVTLILFPFTTMSSLYSLVCRIVNMMLGEIAYLYGDV
FT                   KAGLSFLLKKLTISWIIVVGMILVLSFTVVGFMPSITLYSIILLCIGSKYGGRLPRYIV
FT                   AHYERIKEAWEKGVDDDDCTATPPVECMERIPHKLRPRLACKIAVRAVAKVGLLKRSEA
FT                   NALVYQRVCLDIMESMKMRWHDRLMVLPQAVLACLERPEEVEEVMKAIEASCKGRFDEF
FT                   XGCLLEHRGYNTAVHSVIPDGVLLDHEGMVVRRGLPLSCERKWYSFSSYASTYEYVVHN
FT                   SSLVNVCRGLVERVFCVVRDGKLQRPLRPRKNIFERKLGDVGRKISSIVGFCPAMTRSE
FT                   FCESYSGSRRATYEKARLSLDVLPCTRSDAYLKTFVKAEKINITLKPDPAPRVIQPRDP
FT                   RYNVEVGRYLKPLEPRLMKAIDKLWGERTAIKGYTVEKVGEILYEKSLRFKEPVFVGLD
FT                   ASRFDQHCSRQALEWEHSVYNSIIRDPYLKELLTWQIDNVGTAYLKDGFVRYRVDGCRM
FT                   SGDMNTSMGNYLIMSCLVYQFCKDVGLDASLANCGDDCVLYLEKKQLPLLRHLPNWFES
FT                   MGYSMKVEKPVYNVEEIEFCQQHPVQLSRGWVMVRRPDVCLTKDVCIVRGGMTTDRLQR
FT                   WLYAQRDGGLSLAGDCPVLGQFYNSFPRGESLGELSEYAEAHKFKAGKQYGEITPLSRY
FT                   SFWLAFGLTPDDQLAIEEDLKHWTPEVKLGSEAPRTTLLDYCSR"
FT   CDS             132. .800
FT                   /codon_start=1
FT                   /product="P25"
FT                   /note="replicase associated protein"
FT                   /protein_id="ABV30915.1"
FT                   /translation="MANMVLSCLVTLILFPFTTMSSLYSLVCRIVNMMLGEIAYLYGDV
FT                   KAGLSFLLKKLTISWIIVVGMILVLSFTVVGFMPSITLYSIILLCIGSKYGGRLPRYIV
FT                   AHYERIKEAWEKGVDDDDCTATPPVECMERIPHKLRPRLACKIAVRAVAKVGLLKRSEA
FT                   NALVYQRVCLDIMESMKMRWHDRLMVLPQAVLACLERPEEVEEVMKAIEASCKGRFDEF
FT                   "
FT   CDS             2374. .3534
FT                   /codon_start=1
FT                   /product="P41"
FT                   /note="coat protein"
FT                   /protein_id="ABV30917.1"
FT                   /translation="MEIARTNKNSVVKYVPAAVGAAYQMGKSIVPYAPTIVDALGNVVS
FT                   RATGRKKKSKGKEVQNQIVGGIGAIAAPVSITKRVRGMRPSFRQTKGKVHIVHRELVTS
FT                   VINLVGNFRVNNNVSAQIGQFRINPSNSSLFTWLPTIASNFDSYRFTSIRFVYVPLCAT
FT                   TETGRVSLFWDKDSQDPLPVDRAALSSYGHSNEGPPWAETTLNVPTDGKQRFVTDSNTT
FT                   DRKLVDLGQFAFATYAGGSNNQIGDIYVEYGVEFSEAQPAGGLTQYITKSVGATASTTG
FT                   PSYVVDANINVNATTANVEFFSPGTFLITAVVYGSTIASPSMAGGNGTLIGDLPVVGGS
FT                   NASIWTCVFSTTGVSTSVPTFTQAGTGLTRVQYTITRVNSQTAYQV"
FT   CDS             3615. .4346
FT                   /codon_start=1
FT                   /product="P27"
FT                   /note="movement protein"
FT                   /protein_id="ABV30918.1"
FT                   /translation="MEIQHIDGTFEDSLIVQNEVKKFLISHKTTKAILPLAPYSQLTKW
FT                   KIPKAGFYAPIDVKFVLTPHVSERAQVRGVVKLVDSRDLSPSRELYRSKEFNIGHGLLI
FT                   EGSQLPFCLPVGDYPLQFEVTVLQSQFKETANLYSTSVEWRMMSSTTPLSRVKSVMGAA
FT                   HQPAMKLEPNFKMKLESSKGVSHNQKQRKTTKPNGLDRRGRGNSTVGGSSDASQSQGAQ
FT                   AWGGYHNDLGDSLSEYSVSDL"
FT   CDS             3746. .4204
FT                   /codon_start=1
FT                   /product="P17"
FT                   /note="suppressor of gene silencing"
FT                   /protein_id="ABV30919.1"
FT                   /translation="MENTQGGVLCPNRCKVCSHTTCIRESSGQGGRQASRFTRLITEPR
FT                   IVSEQGIQYRTWIADRGFPIALLSSSGGLSTSIRGHGVAVTVQGDSKSLLNFCRVAYDV
FT                   FNHPVIQSEVCYGRGPSTSDEVRAEFQDEAGIIQGRLPQSETEENNKA"
XX
SQ   Sequence 4431 BP; 1183 A; 909 C; 1146 G; 1193 T; 0 other;

eu127904 Length: 4431  22-SEP-2007  Type: N  Check: 2597  ..

       1  gaatacctac tagaccgtct aaccagcgtg tctgagagtt gcgtagccat
      51  acgtataggt attctctcct aatttagggg tttgaagact gggtctagct
     101  taatagcgga taaattgtaa cttccagtaa aatggcgaac atggtcctaa
     151  gttgcttggt tactctgata ctttttccgt tcacaaccat gtcatcattg
     201  tattctcttg tttgcaggat tgtgaacatg atgttgggtg aaattgcgta
     251  cctttatgga gatgttaagg ctgggttgag ttttctttta aagaaactca
     301  ccatctcttg gataatcgtc gtgggcatga tactggtatt gtcattcact
     351  gtcgtggggt ttatgccatc cattaccttg tacagcatta ttttgctatg
     401  catagggagt aaatatggcg gaaggctgcc acgatacata gttgcccatt
     451  atgagcggat taaggaagcg tgggaaaagg gggttgatga tgatgactgc
     501  acagccacac cacctgtgga atgcatggaa aggatcccac ataagttacg
     551  tccacggctc gcatgcaaga ttgcagttcg tgctgtggca aaggtggggt
     601  tattgaaacg gtctgaagct aatgcccttg tttatcaacg ggtctgtctg
     651  gacatcatgg agagcatgaa gatgaggtgg cacgaccgtc tgatggtcct
     701  acctcaagcc gtgctagctt gcttagaaag gccggaggaa gtcgaggaag
     751  ttatgaaagc cattgaggcg tcctgcaaag gacgcttcga tgagttttag
     801  gggtgcctac tagaacatcg tggctacaac acggccgtcc acagtgtcat
     851  acctgatgga gtgttgttgg accacgaagg gatggtggtt cgaagaggac
     901  tgcccctatc atgtgagcgg aaatggtact ctttttctag ttatgctagc
     951  acttatgagt acgttgtgca caattcctca ctcgttaatg tttgtagagg
    1001  tctggttgaa cgagtgtttt gcgtcgtgcg agacggtaaa ttgcagcgcc
    1051  ctctaagacc aagaaagaat atctttgaga ggaagcttgg tgatgttggt
    1101  cgaaaaatca gctctatcgt tgggttctgc cccgctatga cacgcagtga
    1151  attctgtgaa tcttatagcg gctcgcgaag ggccacgtat gagaaagcgc
    1201  gattgtcctt ggatgttctc ccttgcacta gatctgatgc ttatcttaag
    1251  acatttgtga aagcggagaa gatcaatatc accttgaaac cagacccagc
    1301  gcccagggtc atacagccac gtgatcctag gtataatgtg gaagtgggac
    1351  gttatttgaa gccgttggag ccccgattaa tgaaagcaat cgataaattg
    1401  tggggggaaa ggacggcaat taaggggtat actgttgaga aggtagggga
    1451  gatcttgtac gagaagagtt tgaggtttaa agaacctgtc tttgtggggc
    1501  ttgatgctag ccggtttgac cagcactgct cacgacaggc tttggagtgg
    1551  gaacactccg tgtataactc tattattcgt gatccttacc taaaggagtt
    1601  gctgacatgg caaattgata atgtgggaac tgcgtatctt aaggatggct
    1651  ttgtgcgata tcgtgtcgat ggttgcagga tgtctggtga catgaacacc
    1701  agcatgggaa actatctgat tatgtcatgc cttgtatacc aattctgcaa
    1751  ggatgttgga ttagatgcca gcctcgcaaa ttgcggggac gattgtgtct
    1801  tatatctgga gaaaaagcag ttaccattgc ttaggcacct cccaaattgg
    1851  tttgaatcca tgggttattc tatgaaagtg gaaaaacccg tgtacaatgt
    1901  ggaggaaatt gagttttgtc aacaacatcc cgttcagctc agcagagggt
    1951  gggtaatggt tagaaggcct gatgtctgtt taacaaaaga tgtgtgtatt
    2001  gtccgaggag ggatgacaac tgatcggctt cagaggtggt tgtatgccca
    2051  acgtgatggg ggtctcagct tagcagggga ctgtcccgtt ctagggcagt
    2101  tttacaactc ctttccacgt ggcgagtccc taggggagtt gtcagaatac
    2151  gccgaagcac acaaatttaa ggccggaaag caatatggcg aaattactcc
    2201  attgtcgagg tactcttttt ggctggcatt tgggttaacc cctgatgacc
    2251  agctagctat cgaggaggac cttaaacatt ggacacctga ggtgaagttg
    2301  ggaagcgagg cccctcgcac aactttgctg gactattgct caagataact
    2351  gaccattatc aagtgagaga agtatggaaa tagcgcgaac taataagaac
    2401  agtgttgtga agtatgtacc tgcagcagta ggtgctgctt atcagatggg
    2451  taagtccata gtaccttatg caccaacgat tgttgatgca ttaggtaacg
    2501  tggtatctcg agcaacaggg cgtaaaaaga aaagtaaagg aaaggaagtt
    2551  cagaatcaaa ttgtaggtgg tataggagca attgcagctc ccgttagcat
    2601  taccaagcgt gtgcgaggaa tgaggccttc atttaggcag actaaaggga
    2651  aagtccatat tgtacatcgt gagctcgtta ccagtgtcat taacctggtg
    2701  ggcaactttc gggttaacaa taacgtgagt gcacaaatag ggcaattccg
    2751  tattaatccc tctaattcct ccctgtttac ttggttacca accatagcat
    2801  caaatttcga ctcatataga ttcacatcaa tcaggtttgt ttatgtgcca
    2851  ctatgtgcta ctactgaaac tggtagggtg tcattattct gggataaaga
    2901  ttcacaggat ccccttccag ttgacagagc cgctctaagt tcctacggac
    2951  attcaaacga aggtcctcca tgggcagaga ctacactcaa tgtgccaact
    3001  gatggcaagc aacgttttgt caccgactcg aatacgactg atcgtaagtt
    3051  ggttgacctg ggacagtttg cttttgccac ttatgcagga ggtagcaata
    3101  accaaattgg agacatatat gttgaatatg gggtagagtt ctctgaggcg
    3151  caaccagccg gtggattaac gcaatatatt acaaagtctg tcggggctac
    3201  tgcctccacc actggaccta gttatgtcgt agatgctaat attaatgtta
    3251  acgccacaac agcaaatgta gaattctttt ctcccggaac cttccttata
    3301  accgccgttg tttacggatc cacaatagct tcaccttcca tggcaggtgg
    3351  gaatggtacc ttaattggtg atcttccagt tgtgggaggg tcgaatgctt
    3401  ccatttggac ttgtgtgttt agcaccacag gggtctctac tagtgtccca
    3451  acgtttacac aggcgggcac aggcctaact cgggtgcaat acacgattac
    3501  ccgtgtaaat tcacaaactg cgtatcaggt ttaagggcga aagtaggttg
    3551  gtgtcggaga cttggcaatg tccgagttta gaccttgtgt ggctcaagaa
    3601  gtcttaccag cttcatggaa attcaacata tagatggaac ttttgaggac
    3651  tcattgattg ttcaaaacga ggttaaaaag tttctaatat ctcataagac
    3701  aaccaaagcc atactaccat tagctcccta ctctcaactc actaaatgga
    3751  aaatacccaa ggcggggttc tatgccccaa tagatgtaaa gtttgttctc
    3801  acaccacatg tatcagagag agctcaggtc aggggggtcg tcaagctagt
    3851  cgattcacga gacttatcac cgagccgaga attgtatcgg agcaaggaat
    3901  tcaatatcgg acatggattg ctgatagagg gttcccaatt gcccttttgt
    3951  cttccagtgg gggactatcc acttcaattc gaggtcacgg tgttgcagtc
    4001  acagttcaag gagacagcaa atctctactc aacttctgtc gagtggcgta
    4051  tgatgtcttc aaccaccccg ttatccagag tgaagtctgt tatgggcgcg
    4101  gcccatcaac cagcgatgaa gttagagccg aatttcaaga tgaagctgga
    4151  atcatccaag ggcgtctccc acaatcagaa acagaggaaa acaacaaagc
    4201  ctaatggcct agatcggagg ggtcgtggta atagcaccgt tggtggttct
    4251  tcggatgctt ctcagtccca aggcgcacaa gcatgggggg gttaccataa
    4301  cgatctagga gacagcttat ccgagtactc tgtgtctgac ttgtagagag
    4351  accaccaatg cacaccagaa atgggggcta taagtgtatt ggttcttaat
    4401  tttcatccct tgcgtggaaa cacgctagcc c