Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone Me12-2 major coat protein (CP) gene, complete cds.

ACC No: EU186008

Dated: 2008-09-01 | Length: 672 | CRC: -1473407518

                
ID   EU186008; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EU186008;
XX
DT   01-SEP-2008 (Rel. 97, Created)
DT   01-SEP-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone Me12-2 major coat protein (CP) gene, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Martinez-Salazar N., Oliveros-Garay O.A.;
RT   "Genotypic diversity of six genomic regions of Citrus tristeza virus in
RT   Colombia";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Martinez-Salazar N., Oliveros-Garay O.A.;
RT   ;
RL   Submitted (01-OCT-2007) to the EMBL/GenBank/DDBJ databases.
RL   Agronomia, Universidad Nacional de Colombia, Carrera 30 # 45-03, Bogota
RL   D.C., Cundinamarca 14490, Colombia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="Citrus latifolia grafted on Citrus reshni
FT                   rootstock"
FT                   /isolate="Me12"
FT                   /mol_type="genomic RNA"
FT                   /country="Colombia:Meta-Villavicencio"
FT                   /clone="Me12-2"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="major coat protein"
FT                   /protein_id="ABY82965.1"
FT                   /translation="MDDEPKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEIVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 197 A; 123 C; 171 G; 181 T; 0 other;

eu186008 Length: 672  01-SEP-2008  Type: N  Check: 2525  ..

       1  atggacgacg aaccaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag ctgagtcttc tttcggttcg ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtgtga cgtacactcg ggaaggtgtt gaagtggagt tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaaatcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga