Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone Me12-6 major coat protein (CP) gene, complete cds.

ACC No: EU186012

Dated: 2008-09-01 | Length: 672 | CRC: -1280416021

                
ID   EU186012; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EU186012;
XX
DT   01-SEP-2008 (Rel. 97, Created)
DT   01-SEP-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone Me12-6 major coat protein (CP) gene, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Martinez-Salazar N., Oliveros-Garay O.A.;
RT   "Genotypic diversity of six genomic regions of Citrus tristeza virus in
RT   Colombia";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Martinez-Salazar N., Oliveros-Garay O.A.;
RT   ;
RL   Submitted (01-OCT-2007) to the EMBL/GenBank/DDBJ databases.
RL   Agronomia, Universidad Nacional de Colombia, Carrera 30 # 45-03, Bogota
RL   D.C., Cundinamarca 14490, Colombia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="Citrus latifolia grafted on Citrus reshni
FT                   rootstock"
FT                   /isolate="Me12"
FT                   /mol_type="genomic RNA"
FT                   /country="Colombia:Meta-Villavicencio"
FT                   /clone="Me12-6"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="major coat protein"
FT                   /protein_id="ABY82969.1"
FT                   /translation="MDDETKKLKNKNKDAKEGDDVVAAESSFGSLNFHIDPTLIAMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEIVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 192 A; 128 C; 173 G; 179 T; 0 other;

eu186012 Length: 672  01-SEP-2008  Type: N  Check: 1676  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg atgcgaaaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttcc ttaaacttcc
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaagtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagacaaaga ctttcactta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga cgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaaatcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga