Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate IT major capsid protein gene, complete cds.

ACC No: EU204910

Dated: 2007-11-06 | Length: 597 | CRC: 1193758116

                
ID   EU204910; SV 1; linear; genomic RNA; STD; VRL; 597 BP.
XX
AC   EU204910;
XX
DT   06-NOV-2007 (Rel. 93, Created)
DT   06-NOV-2007 (Rel. 93, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate IT major capsid protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-597
RA   Radaelli P., Fajardo T.V.M., Eiras M., Pio-Ribeiro G., Kuniyuki H.;
RT   "Detection and molecular characterization of the Grapevine
RT   leafroll-associated virus 2 coat protein gene";
RL   Unpublished.
XX
RN   [2]
RP   1-597
RA   Radaelli P., Fajardo T.V.M., Eiras M., Pio-Ribeiro G., Kuniyuki H.;
RT   ;
RL   Submitted (11-OCT-2007) to the EMBL/GenBank/DDBJ databases.
RL   Laboratorio de Virologia, Embrapa Uva e Vinho, Rua Livramento, 515, Bento
RL   Goncalves, RS 95700-000, Brazil
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .597
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /specific_host="Vitis vinifera cv. Italia"
FT                   /isolate="IT"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /db_xref="taxon:64003"
FT   CDS             1. .597
FT                   /codon_start=1
FT                   /product="major capsid protein"
FT                   /protein_id="ABW86965.1"
FT                   /translation="MELMSDSNLSNLVITDASSLNGVDKKLLSAEVVKMLVQKGAPNEG
FT                   IEVVFGLLLYALAARTTSPKVQRADSDVIFSNSFGERNVVVTEGDLKKVLDGCAPLTRF
FT                   TNKLRTFGRTFTEAYVDFCIAYKHKLPQLNAAAELGIPAEDSYLAADFLGTCLKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
XX
SQ   Sequence 597 BP; 163 A; 120 C; 158 G; 156 T; 0 other;

eu204910 Length: 597  06-NOV-2007  Type: N  Check: 624  ..

       1  atggagttga tgtccgacag caaccttagc aacctggtga taaccgacgc
      51  ctctagtcta aatggtgtcg acaagaagct tttatctgct gaagttgtaa
     101  aaatgttggt gcagaaaggg gctcctaacg agggtataga agtggtgttc
     151  ggtctactcc tttacgcact cgcggcaaga accacgtctc ctaaggttca
     201  gcgcgcagat tcagacgtta tattttcaaa tagtttcgga gagaggaatg
     251  tggtagtaac agagggtgac cttaagaagg tactcgacgg gtgtgcgcct
     301  ctcactaggt tcactaataa acttagaacg ttcggtcgta ctttcactga
     351  ggcttacgtt gacttttgta tcgcgtataa gcacaaatta ccccaactca
     401  acgccgcggc ggaattgggg attccagctg aagattcgta cttagctgca
     451  gattttctgg gtacttgcct gaagctctct gaattacagc aaagtaggaa
     501  gatgttcgcg agtatgtacg ctctaaaaac tgaaggtgga gtggtaaata
     551  cgccagtgag caatctgcgt cagctaggta gaagggaagt tatgtaa