Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate RI major capsid protein gene, complete cds.

ACC No: EU204912

Dated: 2007-11-06 | Length: 597 | CRC: -718365068

                
ID   EU204912; SV 1; linear; genomic RNA; STD; VRL; 597 BP.
XX
AC   EU204912;
XX
DT   06-NOV-2007 (Rel. 93, Created)
DT   06-NOV-2007 (Rel. 93, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate RI major capsid protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-597
RA   Radaelli P., Fajardo T.V.M., Eiras M., Pio-Ribeiro G., Kuniyuki H.;
RT   "Detection and molecular characterization of the Grapevine
RT   leafroll-associated virus 2 coat protein gene";
RL   Unpublished.
XX
RN   [2]
RP   1-597
RA   Radaelli P., Fajardo T.V.M., Eiras M., Pio-Ribeiro G., Kuniyuki H.;
RT   ;
RL   Submitted (11-OCT-2007) to the EMBL/GenBank/DDBJ databases.
RL   Laboratorio de Virologia, Embrapa Uva e Vinho, Rua Livramento, 515, Bento
RL   Goncalves, RS 95700-000, Brazil
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .597
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /specific_host="Vitis vinifera cv. Riesling"
FT                   /isolate="RI"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /db_xref="taxon:64003"
FT   CDS             1. .597
FT                   /codon_start=1
FT                   /product="major capsid protein"
FT                   /protein_id="ABW86967.1"
FT                   /translation="MELMSDDNLNNLVITDATSLNGVDKKLLAAEVIKMLVQKGAPNDG
FT                   IEVIFGLLLYALAARTTSPKVQRADSDLIFSNSFGERNVVVTEGDLKKVLDGCAPLTRF
FT                   TNKLRTFGRTFTEAYIDFCIAYKHKLPQLNAAAELGIPAEDSYLAADFLSPCPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
XX
SQ   Sequence 597 BP; 174 A; 127 C; 146 G; 150 T; 0 other;

eu204912 Length: 597  06-NOV-2007  Type: N  Check: 7809  ..

       1  atggagttga tgtccgacga taaccttaac aatctggtga taactgacgc
      51  cactagtcta aatggcgtcg ataagaaact tctagctgcg gaagttataa
     101  aaatgttggt gcaaaagggt gctcctaacg acggtataga agtgatcttc
     151  ggtctacttc tttacgcgct cgcagcaaga actacgtcgc ctaaggttca
     201  gcgcgccgat tctgacttga tattctcaaa cagtttcgga gagagaaacg
     251  tagtggtgac ggagggtgac cttaaaaaag ttctcgacgg gtgtgcgcct
     301  ctcactaggt tcactaacaa acttagaacc ttcggtcgca ctttcactga
     351  ggcctacatc gacttttgta ttgcgtataa gcataagtta cctcaactca
     401  atgccgcagc agaattaggg ataccagctg aagattcata cttagctgca
     451  gattttctaa gcccttgccc gaagctctca gaactgcagc aaagtagaaa
     501  gatgttcgcg agtatgtacg ctctaaaaac agaaggtgga gtggtaaata
     551  cgccagtgag caatctgcgt cagctaggta gaagggaagt tatgtaa