Sequence of DPV Moroccan pepper virus

Moroccan pepper virus isolate MPV-S coat protein gene, complete cds.

ACC No: EU277780

Dated: 2011-12-21 | Length: 1243 | CRC: -1203179034

                
ID   EU277780; SV 1; linear; genomic RNA; STD; VRL; 1243 BP.
XX
AC   EU277780;
XX
DT   01-DEC-2009 (Rel. 103, Created)
DT   21-DEC-2011 (Rel. 111, Last updated, Version 2)
XX
DE   Moroccan pepper virus isolate MPV-S coat protein gene, complete cds.
XX
KW   .
XX
OS   Moroccan pepper virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1243
RA   Rasoulpour R., Izadpanah K.;
RT   "Isolation and Partial Characterization of Pelargonium leaf curl virus,
RT   Moroccan pepper virus";
RL   J. Phytopathol. 159:802-804(2011).
XX
RN   [2]
RP   1-1243
RA   Rasoulpour R., Izadpanah K.;
RT   ;
RL   Submitted (13-NOV-2007) to the INSDC.
RL   Plant Pathology, Plant Virology Research Center, Shiraz, Fars +98 71444,
RL   Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1243
FT                   /organism="Moroccan pepper virus"
FT                   /isolate="MPV-SB"
FT                   /mol_type="genomic RNA"
FT                   /country="Iran:Bajgah"
FT                   /isolation_source="soil"
FT                   /collected_by="R. Rasoulpour"
FT                   /collection_date="Sep-2006"
FT                   /identified_by="R. Rasoulpour"
FT                   /db_xref="taxon:208086"
FT   CDS             14. .1189
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:D2CM02"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:D2CM02"
FT                   /protein_id="ABZ05023.1"
FT                   /translation="MAMVVRNNNTALVPYSGGKRGLQKAFGFGATIVGQKIYDNRGKIV
FT                   GFMVEQGKKGLSKMANALGYGNGQKAQNLVGGMGGAIMAPVALSRQLRGSKPRFTGRTA
FT                   GSVTVTHREYVRQVNNTSAFTVNGGIVGNLYQLNPLNGTLFTWLPSIASNFDQYSFNNI
FT                   TLHYVPLCSTTEVGRVGLYYDKDSQDPEPTDRQELANFSILKETPPWGEVMLRIPTDKI
FT                   KRYCDDSNAVDHKLIDLGQVGIATYGGAGANAVGDVFISYSITLFSPQPTSSLLSTRQQ
FT                   SLLGATGLTTGPSYLTVSSTATVLTLTFRATGTFMVSGHFRDTGAAVLGLAGNINVNSL
FT                   TVLDTVGLATSFSINCSVSALPSTITFTSTAITSSTVHCVRAVRANDATLL"
XX
SQ   Sequence 1243 BP; 318 A; 280 C; 310 G; 335 T; 0 other;

eu277780 Length: 1243  21-DEC-2011  Type: N  Check: 7909  ..

       1  agaaagttac acaatggcaa tggtagtaag aaacaataac acagctttag
      51  taccgtatag tggaggcaaa cgtggcctcc agaaagcatt tggatttgga
     101  gctacaatcg ttgggcaaaa gatttatgat aatcgcggta agattgtagg
     151  gttcatggta gaacaaggaa agaaaggttt aagtaagatg gctaatgctc
     201  ttggttatgg caatggtcag aaagctcaga atctggttgg tgggatgggt
     251  ggggccatta tggcccccgt tgcactctca aggcagcttc gtggaagtaa
     301  accccggttt actggacgta cagctggttc tgtgactgtc acccatcgtg
     351  agtatgtacg acaggtgaac aacacgtctg ccttcacagt caatggaggt
     401  attgtcggga atttgtatca actgaaccct ttgaacggta ctctgttcac
     451  ttggttgcct tccatagcat ccaattttga tcagtattcg ttcaataaca
     501  tcacgttgca ctatgtcccc ctctgcagca ctactgaggt aggtcgtgtt
     551  ggattatact atgacaaaga ctcacaggat cctgagccta ctgataggca
     601  ggagttggcg aactttagca tcctcaaaga gacacccccc tggggtgaag
     651  tgatgttgcg aatacccact gataagatca agaggtactg cgatgacagt
     701  aacgcagtcg atcataagct aattgatttg ggtcaagtag gcattgctac
     751  atatgggggt gctggcgcta acgctgtggg tgatgtgttt atatcgtata
     801  gcattacttt attctcacct cagcccacta gctcattgct aagcacaagg
     851  caacagagcc ttctcggtgc cactggtctc acgacaggcc cgagttactt
     901  gacggtgtcc agtacggcaa ccgttcttac cttgacgttt agagcaactg
     951  gcacttttat ggtctccggt cacttccgtg acaccggagc agccgtattg
    1001  ggtcttgccg gtaacatcaa tgtaaattca ctgacagttt tggatacagt
    1051  tggtctggcc acctcgtttt ccattaattg ctcagtgtct gctttaccgt
    1101  ctaccattac ctttacctcc acagcaataa catcttccac ggtgcactgt
    1151  gtacgggccg taagggccaa tgatgccaca ttgttgtaac tgtatgaggg
    1201  gcttctgaac agaccagttc atgaatcaga gcatcggagc ccg