Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate FN_E coat protein (CP) gene, complete cds.

ACC No: EU288064

Dated: 2008-03-02 | Length: 672 | CRC: -61665891

                
ID   EU288064; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EU288064;
XX
DT   02-MAR-2008 (Rel. 95, Created)
DT   02-MAR-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate FN_E coat protein (CP) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18074213.
RA   Cerni S., Ruscic J., Nolasco G., Gatin Z., Krajacic M., Skoric D.;
RT   "Stem pitting and seedling yellows symptoms of Citrus tristeza virus
RT   infection may be determined by minor sequence variants";
RL   Virus Genes 36(1):241-249(2008).
XX
RN   [2]
RP   1-672
RA   Cerni S., Ruscic J., Nolasco G., Gatin Z., Krajacic M., Skoric D.;
RT   ;
RL   Submitted (19-NOV-2007) to the EMBL/GenBank/DDBJ databases.
RL   Biology/Botany, University of Zagreb, Faculty of Science, Marulicev trg 9a,
RL   Zagreb 10000, Croatia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="Citrus sinensis cv. Fukumoto Navel"
FT                   /isolate="FN_E"
FT                   /mol_type="genomic RNA"
FT                   /country="Croatia"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /note="p25"
FT                   /protein_id="ABZ91166.1"
FT                   /translation="MDDETKTLKNKNKETKEGDDVVAAESSFGSLNFHIDPTLIAMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEIVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 193 A; 130 C; 172 G; 177 T; 0 other;

eu288064 Length: 672  02-MAR-2008  Type: N  Check: 9725  ..

       1  atggacgacg aaacaaagac attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttcc ttaaacttcc
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaagtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagacaaaga ctttcactta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga cgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatc tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaaatcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga