Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CwS1_C coat protein (CP) gene, complete cds.

ACC No: EU288067

Dated: 2008-03-02 | Length: 672 | CRC: -612970082

                
ID   EU288067; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EU288067;
XX
DT   02-MAR-2008 (Rel. 95, Created)
DT   02-MAR-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CwS1_C coat protein (CP) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18074213.
RA   Cerni S., Ruscic J., Nolasco G., Gatin Z., Krajacic M., Skoric D.;
RT   "Stem pitting and seedling yellows symptoms of Citrus tristeza virus
RT   infection may be determined by minor sequence variants";
RL   Virus Genes 36(1):241-249(2008).
XX
RN   [2]
RP   1-672
RA   Cerni S., Ruscic J., Nolasco G., Gatin Z., Krajacic M., Skoric D.;
RT   ;
RL   Submitted (19-NOV-2007) to the EMBL/GenBank/DDBJ databases.
RL   Biology/Botany, University of Zagreb, Faculty of Science, Marulicev trg 9a,
RL   Zagreb 10000, Croatia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="Citrus wilsonii"
FT                   /isolate="CwS1_C"
FT                   /mol_type="genomic RNA"
FT                   /country="Croatia"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /note="p25"
FT                   /protein_id="ABZ91169.1"
FT                   /translation="MDDETKTLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGIEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 191 A; 124 C; 177 G; 180 T; 0 other;

eu288067 Length: 672  02-MAR-2008  Type: N  Check: 1696  ..

       1  atggacgacg aaacaaagac attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcggttcc gtgaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggaacc
     151  caacagaacg ccgcattgaa cagagacttg tttcttactc tgaaagggaa
     201  gtatcctaac ttgcctgaca aggataagga tttccacata gctatgatgt
     251  tatatcgttt agcggttaag agttcatcgt tgcaaagtga tgatgacacc
     301  acgggtataa cgtatactcg ggagggtatt gaagtggatt tgtctgacaa
     351  gctttggact gacgtcgtgt ttaactccaa gggtattggt aaccgtacta
     401  atgcccttcg agtctggggt aggactaacg atgcccttta tttagctttc
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  gattccggct ggatatcatt acctatgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa ggaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga