Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CwS1_E coat protein (CP) gene, complete cds.

ACC No: EU288069

Dated: 2008-03-02 | Length: 672 | CRC: -1839675916

                
ID   EU288069; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EU288069;
XX
DT   02-MAR-2008 (Rel. 95, Created)
DT   02-MAR-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CwS1_E coat protein (CP) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18074213.
RA   Cerni S., Ruscic J., Nolasco G., Gatin Z., Krajacic M., Skoric D.;
RT   "Stem pitting and seedling yellows symptoms of Citrus tristeza virus
RT   infection may be determined by minor sequence variants";
RL   Virus Genes 36(1):241-249(2008).
XX
RN   [2]
RP   1-672
RA   Cerni S., Ruscic J., Nolasco G., Gatin Z., Krajacic M., Skoric D.;
RT   ;
RL   Submitted (19-NOV-2007) to the EMBL/GenBank/DDBJ databases.
RL   Biology/Botany, University of Zagreb, Faculty of Science, Marulicev trg 9a,
RL   Zagreb 10000, Croatia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="Citrus wilsonii"
FT                   /isolate="CwS1_E"
FT                   /mol_type="genomic RNA"
FT                   /country="Croatia"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /note="p25"
FT                   /protein_id="ABZ91171.1"
FT                   /translation="MDDETKTLKNKNKETKEGDDVVAAESSFSSINLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKHPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLNYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYLQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 200 A; 130 C; 165 G; 177 T; 0 other;

eu288069 Length: 672  02-MAR-2008  Type: N  Check: 310  ..

       1  atggacgacg aaacaaagac attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag ctgagtcttc tttcagttcc ataaacttac
     101  acatcgatcc aactttgata gcgatgaatg acgtgcgtca gttgggtacc
     151  caacagaacg ccgctttgaa cagagactta tttctcactt tgaaagggaa
     201  gcatcctaac ttacctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga tgacgacact
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggact tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gaattatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtact tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga