Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CwS3_E coat protein (CP) gene, complete cds.

ACC No: EU288081

Dated: 2008-03-02 | Length: 672 | CRC: -1661983619

                
ID   EU288081; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   EU288081;
XX
DT   02-MAR-2008 (Rel. 95, Created)
DT   02-MAR-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CwS3_E coat protein (CP) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 18074213.
RA   Cerni S., Ruscic J., Nolasco G., Gatin Z., Krajacic M., Skoric D.;
RT   "Stem pitting and seedling yellows symptoms of Citrus tristeza virus
RT   infection may be determined by minor sequence variants";
RL   Virus Genes 36(1):241-249(2008).
XX
RN   [2]
RP   1-672
RA   Cerni S., Ruscic J., Nolasco G., Gatin Z., Krajacic M., Skoric D.;
RT   ;
RL   Submitted (19-NOV-2007) to the EMBL/GenBank/DDBJ databases.
RL   Biology/Botany, University of Zagreb, Faculty of Science, Marulicev trg 9a,
RL   Zagreb 10000, Croatia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="Citrus wilsonii"
FT                   /isolate="CwS3_E"
FT                   /mol_type="genomic RNA"
FT                   /country="Croatia"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /note="p25"
FT                   /protein_id="ABZ91183.1"
FT                   /translation="MDDETKTLKNKNKKTKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYLQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 198 A; 125 C; 169 G; 180 T; 0 other;

eu288081 Length: 672  02-MAR-2008  Type: N  Check: 3085  ..

       1  atggacgacg aaacaaagac attgaagaac aaaaacaaga aaacgaaaga
      51  aggcgacgat gttgttgcag ctgagtcttc tttcggttcg ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcccaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgatgacacc
     301  acgggtgtga cgtacactcg ggaaggtgtt gaagtggagt tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtact tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga